DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15625 and Samd15

Sequence 1:NP_608872.1 Gene:CG15625 FlyBaseID:FBgn0031644 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_017170549.1 Gene:Samd15 MGIID:2685109 Length:694 Species:Mus musculus

Alignment Length:319 Identity:75/320 (23%)
Similarity:120/320 (38%) Gaps:72/320 (23%)


  Fly     9 DTKFLHQKVKKKTKIRS-----DMAPTKFQRNEFLKGCPKYDGDDIPIQFRTTPDSLVELSIIVV 68
            |...|..|:|.:..:.|     :...|.::..||||.......:..||...:...:.:..|.::.
Mouse   392 DKLALPAKIKTEFIVGSPRESVESFSTLYETQEFLKDLQTDMNELFPIVDASESQTELRDSTVLP 456

  Fly    69 DKLPL-------PSI---FE---WDDMDIRRWINGYGYPQYMNTFRVNMITGRKLLLLDASALCA 120
            .::.|       ||:   ||   |....:..||:..|:|||...|..|.|.|:||:.::.|.|..
Mouse   457 QEVELLGRKETKPSLTPEFEHLTWSPERVAEWISDLGFPQYKECFTENFINGQKLIHVNCSNLPQ 521

  Fly   121 MNIKNFDHIRHISYGIRMLFHFELTKFSSSISLPDEKPNELYLLFHTQTGVNYD----------- 174
            |.|.:|:.::.|||..|:|...|...||.|||||......|:......:||..|           
Mouse   522 MGITDFEDMKAISYHTRVLLGIEEPLFSRSISLPYRDNKGLFFEQKGHSGVKSDSLTLAKFVEAA 586

  Fly   175 -----------EVRRSDLYRRMQMLRERA-------RNLDHWDLLYLWLRHEQERKYKELIGMVP 221
                       |.::.|......:....|       ::...:..:||::      .|.|:     
Mouse   587 GLQEYNPEIKAEEKKEDALPENSLEENEAIYQIFFFKSFSFYLFIYLFI------YYMEV----- 640

  Fly   222 RFTMYKCEEAAKPPEEPEDMEPEELMCMTCIPPCDCDWTARDLRLPWRLECLPPMLETT 280
               .|.|.:..:..|       .:|:...|.|||.| |   ||.....:.|..|:...|
Mouse   641 ---HYSCLQTLQKRE-------SDLVTDGCEPPCGC-W---DLNSGRAVGCSYPLSHLT 685

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15625NP_608872.1 SAM_Samd14 77..143 CDD:188929 25/69 (36%)
SAM 78..139 CDD:197735 23/64 (36%)
Samd15XP_017170549.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CMVG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0008070
OrthoInspector 1 1.000 T616732
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5600
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.