DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15625 and SAMD15

DIOPT Version :9

Sequence 1:NP_608872.1 Gene:CG15625 / 33694 FlyBaseID:FBgn0031644 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001010860.1 Gene:SAMD15 / 161394 HGNCID:18631 Length:674 Species:Homo sapiens


Alignment Length:222 Identity:56/222 - (25%)
Similarity:88/222 - (39%) Gaps:47/222 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YGIADTKFLHQKVKKKTKIRSDMAPTKFQRNEFLKGCPKYDGDDI--------PIQ--------- 52
            |.:.:.:..|::.|:.....||    ||::..:..|..:...:.|        |:|         
Human   432 YSVGNDELEHREPKRGKLSLSD----KFRKEYYALGSLRESEESIGTHYEFLQPLQKLLNVSEEC 492

  Fly    53 -FRTTPDSLVELSIIVVDKLPLPSIFE-------------------------WDDMDIRRWINGY 91
             :....:|..|||..|.:|..:....|                         ||..::..||:..
Human   493 SYSDPSESQTELSEFVHEKEVVDLSQELKERVSEDDETQPEKGTELQFEHLNWDPEEVAEWISQL 557

  Fly    92 GYPQYMNTFRVNMITGRKLLLLDASALCAMNIKNFDHIRHISYGIRMLFHFELTKFSSSISLPDE 156
            |:|||...|..|.|:||||:.::.|.|..|.|.||:.::.||...:.|...|...|..|||||..
Human   558 GFPQYKECFITNFISGRKLIHVNCSNLPQMGITNFEDMKAISRHTQELLEIEEPLFKRSISLPYR 622

  Fly   157 KPNELYLLFHTQTGVNYDEVRRSDLYR 183
            ....|||.....||:..|.:..|:..:
Human   623 DIIGLYLEQKGHTGIKSDSLTLSEFVK 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15625NP_608872.1 SAM_Samd14 77..143 CDD:188929 25/90 (28%)
SAM 78..139 CDD:197735 24/85 (28%)
SAMD15NP_001010860.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..448 3/15 (20%)
ftsN 137..>310 CDD:274041
SAM_Samd14 543..609 CDD:188929 24/65 (37%)
SAM 544..607 CDD:197735 24/62 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11485
eggNOG 1 0.900 - - E1_2CMVG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009897
OrthoInspector 1 1.000 - - otm40460
orthoMCL 1 0.900 - - OOG6_109459
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5600
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.790

Return to query results.
Submit another query.