DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15625 and samd15

Sequence 1:NP_608872.1 Gene:CG15625 FlyBaseID:FBgn0031644 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_002938914.2 Gene:samd15 ID: Length:132 Species:Xenopus tropicalis

Alignment Length:111 Identity:34/112 (30%)
Similarity:58/112 (52%) Gaps:0/112 (0%)


  Fly    74 PSIFEWDDMDIRRWINGYGYPQYMNTFRVNMITGRKLLLLDASALCAMNIKNFDHIRHISYGIRM 138
            |....|...::..|:...|:|||...|..|.|:||||:.::.|.|..:.:.:|.|::.||..||.
 Frog    19 PDCLRWSCREVGGWLRFKGFPQYEACFTQNYISGRKLIHVNCSTLPQIGVTDFQHMKEISRLIRD 83

  Fly   139 LFHFELTKFSSSISLPDEKPNELYLLFHTQTGVNYDEVRRSDLYRR 184
            |.:.....::.|:|||......|:|...:|||:|.:.:..|...::
 Frog    84 LLNITEPLWTRSVSLPHRDNMGLFLEKKSQTGLNTESLTYSQFIKQ 129

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15625NP_608872.1 SAM_Samd14 77..143 CDD:188929 22/66 (33%)
SAM 78..139 CDD:197735 21/61 (34%)
samd15XP_002938914.2 SAM_superfamily 22..87 CDD:301707 22/65 (34%)
SAM 24..86 CDD:197735 22/62 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0008070
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.