DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cf2 and wor

Sequence 1:NP_001350854.1 Gene:Cf2 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_476601.1 Gene:wor FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster

Alignment Length:309 Identity:81/310 (26%)
Similarity:123/310 (40%) Gaps:71/310 (23%)


  Fly   199 QQEAAVTPDDQL------PAMAPRDMRLTPEE--------QHHQQQLQAEHHHQQQH------QQ 243
            ::|....|..||      |...|.|:.:|...        |:..:.|.:..|...||      .:
  Fly   183 KEEIPPIPSPQLFYPPPTPLAEPEDLSVTQRRVLSENMNLQNVARALLSMQHMAPQHAPPPIDME 247

  Fly   244 QQQQQQQQQELLEQQQREMQEQAQQQQVHHHQQDQDLAGDQVALKVPPLTVKLNK-NANGGAIVS 307
            :.|:.|...:|..:...::..|.||                           .|| .|....:|.
  Fly   248 EDQENQDINQLKIKSSNDLYYQCQQ---------------------------CNKCYATYAGLVK 285

  Fly   308 HPQV---------IIKEEPLSLSDSGDVVNSVPVYAIQANPGVPAP--ASSGVLVGTQTVPADLA 361
            |.|.         ||:.:|   ..||.:|:.......||:..:.|.  ||:..:.....||    
  Fly   286 HQQTHAYESTEYKIIRSQP---GGSGAIVDQTEFCTDQASALIQAANVASAQSMQKPVGVP---- 343

  Fly   362 HKIRHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGE 426
               |:.|.||.|::.|...|:.|::.|...|:....::.::|..|.|::.....||.|.|.||  
  Fly   344 ---RYHCQDCGKSYSTYSGLSKHQQFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTHT-- 403

  Fly   427 KPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVH 475
            .|..|..|.|:||....|..||||||||||::|.:|::.|..||.|..|
  Fly   404 LPCKCPICGKAFSRPWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAH 452

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 41/107 (38%)
C2H2 Zn finger 368..388 CDD:275368 7/20 (35%)
C2H2 Zn finger 403..423 CDD:275368 7/20 (35%)
C2H2 Zn finger 431..451 CDD:275368 10/20 (50%)
zf-H2C2_2 443..468 CDD:316026 14/25 (56%)
C2H2 Zn finger 459..480 CDD:275368 7/18 (39%)
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 8/47 (17%)
C2H2 Zn finger 317..334 CDD:275368 5/17 (29%)
zf-C2H2 345..367 CDD:278523 7/22 (32%)
C2H2 Zn finger 347..367 CDD:275368 7/20 (35%)
PHA00732 379..>417 CDD:177300 15/40 (38%)
C2H2 Zn finger 382..402 CDD:275368 7/20 (35%)
zf-C2H2_8 405..482 CDD:292531 24/49 (49%)
zf-C2H2 406..428 CDD:278523 10/22 (45%)
C2H2 Zn finger 408..428 CDD:275368 10/20 (50%)
zf-H2C2_2 421..444 CDD:290200 14/23 (61%)
zf-C2H2 434..456 CDD:278523 7/20 (35%)
C2H2 Zn finger 436..456 CDD:275368 7/18 (39%)
zf-H2C2_2 448..473 CDD:290200 2/6 (33%)
C2H2 Zn finger 464..481 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C123610887
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I2553
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.980

Return to query results.
Submit another query.