DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Clect27 and LOC110439976

Sequence 1:NP_001260046.1 Gene:Clect27 FlyBaseID:FBgn0031629 Length:231 Species:Drosophila melanogaster
Sequence 2:XP_021333800.1 Gene:LOC110439976 ID: Length:144 Species:Danio rerio

Alignment Length:139 Identity:27/140 (19%)
Similarity:46/140 (33%) Gaps:55/140 (39%)


  Fly    55 NMFLTTHVPALANKKVDWLDGRNLCREYCMDL-----VALETQEKNNLIFRVIQQNDVPYIWTAG 114
            ::|:.|:        :.|::.::.||...:||     |...|...||||:..:.:     .|   
Zfish     3 SLFIRTN--------LTWIEAQSFCRTKYVDLAFISGVTDNTDVLNNLIWYSVYE-----AW--- 51

  Fly   115 RICDFAGCENRPDLEPKTVYGWFWSATREKIQATNRIPQGWGYNPWSQTGHKKRPQPDNAEYDIN 179
                 .|.....         |.||         ::....|....||.      .:|:||:    
Zfish    52 -----IGLSKNQ---------WLWS---------DQSSVSWPSLGWSS------GEPNNAD---- 83

  Fly   180 QTKEQCLSV 188
             ..|:|..|
Zfish    84 -GNEKCAFV 91

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Clect27NP_001260046.1 CLECT 67..213 CDD:153057 25/128 (20%)
LOC110439976XP_021333800.1 CLECT 4..110 CDD:321932 27/139 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1038166at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.