DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Clect27 and LOC101883025

Sequence 1:NP_001260046.1 Gene:Clect27 FlyBaseID:FBgn0031629 Length:231 Species:Drosophila melanogaster
Sequence 2:XP_021322565.1 Gene:LOC101883025 ID: Length:429 Species:Danio rerio

Alignment Length:129 Identity:27/130 (21%)
Similarity:48/130 (37%) Gaps:36/130 (28%)


  Fly    65 LANKKVDWLDGRNLCREYCMDLVALETQEKNNLIFRVIQQNDVPYIWTAGR-ICDFAGCENRPDL 128
            |.|..:.|.:..:.||:..:||:::.:::..|...|...|....::|...| .|:|:        
Zfish   313 LVNDNLTWTEAVSYCRKNHVDLISIHSEKLQNRAARKAIQASSSHVWIGLRYTCNFS-------- 369

  Fly   129 EPKTVYGWFWSATREKIQATNRI----PQGW------------GYNPWSQTGHKKRPQPDNAEY 176
                  .|||...||.....|.:    |.|:            |::.|.     .||:.|...:
Zfish   370 ------FWFWINNREAGCYQNWVSGHGPHGFVECGLSGAMESNGWHRWI-----GRPESDRLNF 422

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Clect27NP_001260046.1 CLECT 67..213 CDD:153057 26/128 (20%)
LOC101883025XP_021322565.1 CLECT 33..>112 CDD:321932
CLECT 313..424 CDD:153057 27/130 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1038166at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.