DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Clect27 and si:ch211-225k7.4

Sequence 1:NP_001260046.1 Gene:Clect27 FlyBaseID:FBgn0031629 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001116876.1 Gene:si:ch211-225k7.4 ZFINID:ZDB-GENE-060503-28 Length:367 Species:Danio rerio

Alignment Length:178 Identity:40/179 (22%)
Similarity:68/179 (38%) Gaps:55/179 (31%)


  Fly    57 FLTTHVPALANKKVDWLDGRNLCREYCMDLVALETQEKNNLIFRVI--QQNDVPYIWTAGRICDF 119
            |.|:.......:.::|.|.::.||:..:|||::..|.:|..:.:.|  :::....:| .|...| 
Zfish   130 FNTSRGLVFVKQTMNWRDAQSYCRQNHIDLVSVRNQNENQQLEKFINDRKSSGSTVW-IGLFRD- 192

  Fly   120 AGCENRPDLEPKTVYGWFWSATREKIQATNRIPQGWGYNPWSQTGHKKRPQPDNAEYDINQTKEQ 184
                           .|.||   ::..::.|.   |..|           ||||     ....|.
Zfish   193 ---------------SWQWS---DQSSSSFRY---WDNN-----------QPDN-----RGGIEN 220

  Fly   185 CLSVLNNVYNDGIAWHDVACYH--------EKPVICEDN---EELLRY 221
            |..:..||...   |||::|.|        :|.::.:.|   .|.|||
Zfish   221 CTVITQNVQRQ---WHDISCEHHFCFVLCPDKLLVVQQNLLWSEALRY 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Clect27NP_001260046.1 CLECT 67..213 CDD:153057 33/156 (21%)
si:ch211-225k7.4NP_001116876.1 CLECT 23..131 CDD:295302 1/1 (100%)
CLECT 134..244 CDD:295302 32/152 (21%)
CLECT 251..364 CDD:153057 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1038166at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.