DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Clect27 and si:dkey-28d5.3

Sequence 1:NP_001260046.1 Gene:Clect27 FlyBaseID:FBgn0031629 Length:231 Species:Drosophila melanogaster
Sequence 2:XP_009301145.1 Gene:si:dkey-28d5.3 ZFINID:ZDB-GENE-060503-919 Length:361 Species:Danio rerio

Alignment Length:168 Identity:35/169 (21%)
Similarity:58/169 (34%) Gaps:61/169 (36%)


  Fly    67 NKKVDWLDGRNLCREYCMDLVALETQEKNNLIFRVI-QQNDVPYIWTAGRICDFAGCENRPDLEP 130
            |::::|.|.::.||:..:|||::..|.:|..:...| .:|...:|   |...|            
Zfish   140 NQEMNWRDAQSYCRQNHIDLVSVRNQNENQQLEMFINDRNSAAWI---GLFRD------------ 189

  Fly   131 KTVYGWFWSATREKIQATNRIPQGWGYNPWSQTGHKKRPQPDNAEYDINQTKEQCLSVLNNVYND 195
                .|.||.....           .:..|:         |:|.:...|...|.  ..|..    
Zfish   190 ----SWQWSDQSNS-----------SFRYWA---------PNNPKVAYNAVIEP--KTLGQ---- 224

  Fly   196 GIAWHD-VACYHEKPVICEDNE-----------ELLRY 221
               |.| .:.||:.|.||.:::           |.|||
Zfish   225 ---WGDYFSPYHQYPFICHEDKLIVIQQNLSWSEALRY 259

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Clect27NP_001260046.1 CLECT 67..213 CDD:153057 31/148 (21%)
si:dkey-28d5.3XP_009301145.1 CLECT 23..131 CDD:295302
CLECT_1 134..240 CDD:153072 31/148 (21%)
CLECT 246..358 CDD:153057 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1038166at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.