DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and Chl1

DIOPT Version :10

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_038964701.1 Gene:Chl1 / 89828 RGDID:620122 Length:1224 Species:Rattus norvegicus


Alignment Length:452 Identity:105/452 - (23%)
Similarity:173/452 - (38%) Gaps:108/452 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LSLSPAE----HSVVRYTNESLIVQCRS---PDPKVELHWKSPKGEIIREHKGRIHIEQTSTEQL 82
            |.|.||:    .|......::|:::|.:   |.|::|  |.....|:   .|||..|| ...:.|
  Rat   252 LLLPPAQIGSASSKTVLKGDTLLLECFAEGLPTPQIE--WSKLGSEL---PKGRATIE-IHEKTL 310

  Fly    83 KIVFAHIALADKGNWSCEAAD--GSLHSKSFDLIVYQKITFTENATVMTVKEGEKATILCEVKGE 145
            ||  .:::..|:||:.|.|.:  |.. |..|.:||.:...:.:.........|....:|||.:||
  Rat   311 KI--ENVSYQDRGNYRCTANNLLGKA-SHDFHVIVEEPPRWKKKPQSAVYSTGSNGILLCEAEGE 372

  Fly   146 PQPNVTWHFNGQPISAGAADDSKFR---ILADGLLINKVTQNDTGEYACRAYQVNSIASDMQERT 207
            |||.:.|..||.||     ::..|.   :....:....:..|.|..|.|.|..::.        |
  Rat   373 PQPTIKWRVNGLPI-----ENHPFPGDVMFPREISFTNLQPNHTAVYQCEASNIHG--------T 424

  Fly   208 VLMKIEHKPIWSKTPFVSLK----YAYING-TATLMCEALAEPPANFTWYRKHNKLH--SNNRLY 265
            :|.. .:..:....|.:..|    |..:.| :|.|.||..|.|.|...| ...::.|  ...|.:
  Rat   425 ILAN-ANIDVVDVVPLIQTKNEENYETVVGYSAFLHCEYFASPKATVVW-EVADETHPLEGGRYH 487

  Fly   266 TIQSDSYWSSLTIHVLNTSAFD--NYRCRARNDLGTIERTTRLEQGEKPPSPANFQLRGFNSNTF 328
            |.::.      |:.:..|:..|  :|.|...|.:|            |....||..:|  |:...
  Rat   488 THENG------TLEIERTTEEDAGSYSCWVDNTMG------------KAVITANLDIR--NATKL 532

  Fly   329 DVVLSAPRGPPDSPMGVNGFRIEYMTEM--EFKTDAG-------KWTNARRKD-YAFE------- 376
            .|....||.|.           .::.|:  |.:.|:.       .|:    || .|||       
  Rat   533 RVFPKNPRIPK-----------SHVLELYCESQCDSHLKHSLKLSWS----KDGEAFEMNGTEDG 582

  Fly   377 ----EGATFLLTNL--EPDTVYLVRA--ASRNLAGFSDFTKV---EKYKTLSLEPRVSSGVK 427
                :||...::|:  |...:|...|  |..:.:|.:..|.:   :..:.|.|..|.:..|:
  Rat   583 RIVIDGANLTISNISGEDQGIYSCSAQTALDSTSGKTQVTVLGVPDPPRNLLLSERQNRSVR 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 24/86 (28%)
IgI_Twitchin_like 120..208 CDD:409541 20/90 (22%)
Ig strand A 120..123 CDD:409541 0/2 (0%)
Ig strand A' 127..131 CDD:409541 0/3 (0%)
Ig strand B 134..141 CDD:409541 1/6 (17%)
Ig strand C 149..154 CDD:409541 1/4 (25%)
Ig strand C' 156..159 CDD:409541 1/2 (50%)
Ig strand D 165..170 CDD:409541 0/4 (0%)
Ig strand E 173..178 CDD:409541 0/4 (0%)
Ig strand F 187..195 CDD:409541 3/7 (43%)
Ig strand G 198..208 CDD:409541 0/9 (0%)
IG_like 228..307 CDD:214653 20/83 (24%)
Ig strand B 235..239 CDD:409353 2/3 (67%)
Ig strand C 248..252 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 0/3 (0%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
FN3 312..415 CDD:238020 26/130 (20%)
Chl1XP_038964701.1 Ig 34..125 CDD:472250
Ig strand B 52..56 CDD:409353
Ig strand C 65..69 CDD:409353
Ig strand E 89..93 CDD:409353
Ig strand F 105..110 CDD:409353
Ig strand G 119..122 CDD:409353
IgI_2_L1-CAM_like 134..224 CDD:409432
Ig strand A 134..137 CDD:409432
Ig strand A' 139..143 CDD:409432
Ig strand B 146..154 CDD:409432
Ig strand C 161..167 CDD:409432
Ig strand C' 170..173 CDD:409432
Ig strand D 179..183 CDD:409432
Ig strand E 185..189 CDD:409432
Ig strand F 200..208 CDD:409432
Ig strand G 211..224 CDD:409432
Ig 261..343 CDD:472250 25/90 (28%)
Ig strand B 273..277 CDD:409353 1/3 (33%)
Ig strand C 286..290 CDD:409353 1/5 (20%)
Ig strand E 308..312 CDD:409353 1/3 (33%)
Ig strand F 322..327 CDD:409353 2/4 (50%)
Ig strand G 335..338 CDD:409353 1/2 (50%)
Ig4_L1-NrCAM_like 347..434 CDD:409367 22/100 (22%)
Ig strand B 363..367 CDD:409367 0/3 (0%)
Ig strand C 376..380 CDD:409367 0/3 (0%)
Ig strand E 399..403 CDD:409367 0/3 (0%)
Ig strand F 413..418 CDD:409367 2/4 (50%)
Ig strand G 426..429 CDD:409367 1/3 (33%)
Ig 447..524 CDD:472250 22/95 (23%)
Ig strand B 456..460 CDD:409353 2/3 (67%)
Ig strand C 469..473 CDD:409353 1/4 (25%)
Ig strand E 492..496 CDD:409353 1/9 (11%)
Ig strand F 506..511 CDD:409353 2/4 (50%)
Ig strand G 519..522 CDD:409353 0/2 (0%)
Ig 528..627 CDD:472250 23/113 (20%)
Ig strand B 547..551 CDD:409353 1/3 (33%)
Ig strand C 564..568 CDD:409353 0/3 (0%)
Ig strand E 589..593 CDD:409353 1/3 (33%)
Ig strand F 603..608 CDD:409353 1/4 (25%)
Ig strand G 616..619 CDD:409353 1/2 (50%)
FN3 <626..>867 CDD:442628 4/19 (21%)
FN3 627..716 CDD:238020 4/18 (22%)
FN3 832..926 CDD:238020
FN3 931..1026 CDD:238020
Bravo_FIGEY 1120..1205 CDD:464016
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.