DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and Hmcn2

DIOPT Version :10

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_006498564.1 Gene:Hmcn2 / 665700 MGIID:2677838 Length:5092 Species:Mus musculus


Alignment Length:444 Identity:110/444 - (24%)
Similarity:184/444 - (41%) Gaps:76/444 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SVVRYTNESLIVQCRS---PDPKVELHWKSPKGEIIREHKGRIHIEQTSTEQLKIVFAHIALADK 94
            |||  .|||:.::|:|   |.|  .|.|:. .|..:..|.|    .:.|.::..:.....|:.|.
Mouse  2102 SVV--VNESVTLECQSHAVPPP--VLRWQK-DGRPLEPHPG----IRLSADKALLEVDRAAVWDA 2157

  Fly    95 GNWSCEAADGSLHS-KSFDLIVYQKITF-TENATVMTVKEGEKATILCEVKGEPQPNVTWHFNGQ 157
            |:::|||.:.:..| |.|:|.|:....| ::....:||.||:.|.:.|:.:|.|.|.::|..:||
Mouse  2158 GHYTCEAINQAGRSEKHFNLHVWVPPAFPSKEPYTLTVTEGQTARLSCDCQGIPFPKISWRKDGQ 2222

  Fly   158 PISAGAADDSKFRILADG--LLINKVTQNDTGEYACRAYQVNSIASDMQERTVLMKIEHKPIWSK 220
            |:.  ...||..::||.|  |.:.:......|.|.|........:|..|...||:..:...:|..
Mouse  2223 PLP--GEGDSLEQVLAVGRLLYLGQAQSAQEGTYTCECSNAAGTSSQEQSLEVLVPPQVTGLWEP 2285

  Fly   221 TPFVSLKYAYINGTATLMCEALAEPPANFTWYRKHNKLHSNNRLYTIQSDSYWSSLTIHVLNTSA 285
            ...||:   ..:|..||.|.|..:|....||.|....:.....| .:|:.::  ||.:.....|.
Mouse  2286 LTTVSV---IQDGNTTLACNATGKPLPVVTWQRDGQPVSVEPGL-RLQNQNH--SLHVERAQASH 2344

  Fly   286 FDNYRCRARNDLGTIERTTRLEQGEKPPSPANFQLRGFNSNTFDVV---------------LSAP 335
            ...|.|.|.|..|..||...|.....|      .|.|.:.:..:|.               :.||
Mouse  2345 AGGYSCVAENTAGRAERRFALSVLAPP------HLTGDSDSLTNVTATLHGSFTLLCEAAGVPAP 2403

  Fly   336 ------RGPPDSP-----MGVNGFRIEYMTEMEFKTDAGKWTNARRKDYAFEEGATFLLTNLEPD 389
                  .|.|.||     :...|:.:: ||:.: :.|.|.: :....:.|.|....|.:..|.|.
Mouse  2404 TVQWFQEGQPISPREGTYLLAGGWMLK-MTQAQ-EQDRGLY-SCLASNEAGEARRNFSVEVLVPP 2465

  Fly   390 TVYLVRAASRNLAGFSDFTKVEKYKTLSLE--------PRVSSGVKETRNMCVE 435
            ::     .:.:|   .:..||.:.:|..||        |:| :..|:.:::.||
Mouse  2466 SI-----ENEDL---EEVIKVPEGQTAQLECNATGHPPPKV-TWFKDGQSLTVE 2510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 26/85 (31%)
IgI_Twitchin_like 120..208 CDD:409541 25/90 (28%)
Ig strand A 120..123 CDD:409541 1/3 (33%)
Ig strand A' 127..131 CDD:409541 1/3 (33%)
Ig strand B 134..141 CDD:409541 1/6 (17%)
Ig strand C 149..154 CDD:409541 1/4 (25%)
Ig strand C' 156..159 CDD:409541 2/2 (100%)
Ig strand D 165..170 CDD:409541 2/4 (50%)
Ig strand E 173..178 CDD:409541 3/6 (50%)
Ig strand F 187..195 CDD:409541 3/7 (43%)
Ig strand G 198..208 CDD:409541 2/9 (22%)
IG_like 228..307 CDD:214653 21/78 (27%)
Ig strand B 235..239 CDD:409353 2/3 (67%)
Ig strand C 248..252 CDD:409353 1/3 (33%)
Ig strand E 274..278 CDD:409353 2/3 (67%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
FN3 312..415 CDD:238020 23/128 (18%)
Hmcn2XP_006498564.1 ChlD <3..208 CDD:440853
Ig <449..514 CDD:472250
Ig strand C 458..462 CDD:409405
Ig strand E 480..484 CDD:409405
Ig strand F 494..499 CDD:409405
Ig strand G 507..510 CDD:409405
IG_like 525..605 CDD:214653
Ig strand B 535..539 CDD:409544
Ig strand C 548..552 CDD:409544
Ig strand E 571..575 CDD:409544
Ig strand F 585..590 CDD:409544
Ig strand G 598..601 CDD:409544
I-set 609..693 CDD:400151
Ig strand B 626..630 CDD:409353
Ig strand C 639..643 CDD:409353
Ig strand E 661..665 CDD:409353
Ig strand F 675..680 CDD:409353
Ig strand G 689..692 CDD:409353
IG_like 707..783 CDD:214653
Ig strand B 716..720 CDD:409353
Ig strand C 729..733 CDD:409353
Ig strand E 749..753 CDD:409353
Ig strand F 763..768 CDD:409353
IG_like 793..876 CDD:214653
Ig strand B 804..808 CDD:409390
Ig strand C 817..821 CDD:409390
Ig strand E 842..846 CDD:409390
Ig strand F 856..861 CDD:409390
Ig strand G 869..872 CDD:409390
I-set 889..969 CDD:400151
Ig strand B 899..903 CDD:409550
Ig strand C 913..917 CDD:409550
Ig strand F 949..954 CDD:409550
Ig strand G 962..965 CDD:409550
Ig_3 972..1046 CDD:464046
Ig 1076..1157 CDD:472250
Ig strand B 1087..1091 CDD:409544
Ig strand C 1100..1104 CDD:409544
Ig strand E 1123..1127 CDD:409544
Ig strand F 1137..1142 CDD:409544
Ig strand G 1150..1153 CDD:409544
Ig 1161..1242 CDD:472250
Ig strand B 1178..1182 CDD:409420
Ig strand C 1191..1195 CDD:409420
Ig strand E 1206..1213 CDD:409420
Ig strand F 1222..1227 CDD:409420
Ig strand G 1235..1238 CDD:409420
Ig 1260..1336 CDD:472250
Ig strand B 1265..1269 CDD:409358
Ig strand C 1278..1282 CDD:409358
Ig strand E 1302..1306 CDD:409358
Ig strand F 1316..1321 CDD:409358
Ig strand G 1329..1332 CDD:409358
I-set 1345..1429 CDD:400151
Ig strand B 1359..1363 CDD:409353
Ig strand C 1372..1376 CDD:409353
Ig strand E 1395..1399 CDD:409353
Ig strand F 1409..1414 CDD:409353
Ig strand G 1422..1425 CDD:409353
I-set 1449..1523 CDD:400151
Ig strand B 1452..1456 CDD:409544
Ig strand C 1465..1469 CDD:409544
Ig strand E 1488..1493 CDD:409544
Ig strand F 1503..1508 CDD:409544
IG_like 1553..1633 CDD:214653
Ig strand B 1563..1567 CDD:409353
Ig strand C 1576..1580 CDD:409353
Ig strand E 1599..1603 CDD:409353
Ig strand F 1613..1618 CDD:409353
Ig 1643..1728 CDD:472250
Ig strand B 1657..1661 CDD:409400
Ig strand C 1670..1674 CDD:409400
Ig strand E 1692..1696 CDD:409400
Ig strand F 1706..1711 CDD:409400
Ig strand G 1721..1724 CDD:409400
Ig 1741..1819 CDD:472250
Ig strand B 1749..1753 CDD:409353
Ig strand C 1762..1766 CDD:409353
Ig strand E 1784..1789 CDD:409353
Ig strand F 1799..1804 CDD:409353
Ig strand G 1812..1815 CDD:409353
Ig 1839..1903 CDD:472250
Ig strand B 1841..1845 CDD:409353
Ig strand C 1854..1858 CDD:409353
Ig strand E 1869..1873 CDD:409353
Ig strand F 1883..1888 CDD:409353
I-set 1907..1986 CDD:400151
Ig strand B 1924..1928 CDD:409562
Ig strand C 1937..1941 CDD:409562
Ig strand E 1960..1964 CDD:409562
Ig strand F 1974..1979 CDD:409562
Ig strand G 1987..1990 CDD:409562
Ig_3 1997..2073 CDD:464046
Ig_3 2091..2166 CDD:464046 22/72 (31%)
Ig 2183..2273 CDD:472250 25/91 (27%)
Ig strand B 2201..2205 CDD:409420 1/3 (33%)
Ig strand C 2214..2218 CDD:409420 0/3 (0%)
Ig strand E 2239..2243 CDD:409420 1/3 (33%)
Ig strand F 2253..2258 CDD:409420 2/4 (50%)
Ig strand G 2266..2269 CDD:409420 1/2 (50%)
Ig 2291..2367 CDD:472250 22/81 (27%)
Ig strand B 2297..2301 CDD:409544 2/3 (67%)
Ig strand C 2310..2314 CDD:409544 1/3 (33%)
Ig strand E 2333..2337 CDD:409544 2/5 (40%)
Ig strand F 2347..2352 CDD:409544 2/4 (50%)
Ig strand G 2360..2363 CDD:409544 2/2 (100%)
Ig 2380..2461 CDD:472250 15/83 (18%)
Ig strand B 2391..2395 CDD:409353 0/3 (0%)
Ig strand C 2404..2408 CDD:409353 0/3 (0%)
Ig strand E 2426..2431 CDD:409353 1/5 (20%)
Ig strand F 2441..2446 CDD:409353 0/5 (0%)
Ig strand G 2454..2457 CDD:409353 0/2 (0%)
I-set 2476..2554 CDD:400151 10/36 (28%)
Ig strand B 2484..2488 CDD:409353 1/3 (33%)
Ig strand C 2497..2501 CDD:409353 1/4 (25%)
Ig strand E 2520..2524 CDD:409353
Ig strand F 2534..2539 CDD:409353
I-set 2558..2650 CDD:400151
Ig strand B 2580..2584 CDD:409393
Ig strand C 2593..2597 CDD:409393
Ig strand E 2617..2620 CDD:409393
Ig strand F 2630..2635 CDD:409393
Ig strand G 2643..2646 CDD:409393
I-set 2668..2740 CDD:400151
Ig strand B 2678..2682 CDD:409353
Ig strand C 2691..2695 CDD:409353
Ig strand E 2714..2718 CDD:409353
Ig strand F 2728..2733 CDD:409353
Ig 2782..2859 CDD:472250
Ig strand B 2789..2793 CDD:409353
Ig strand C 2802..2806 CDD:409353
Ig strand E 2827..2831 CDD:409353
Ig strand F 2839..2844 CDD:409353
Ig strand G 2852..2855 CDD:409353
I-set 2876..2954 CDD:400151
Ig strand B 2884..2888 CDD:409562
Ig strand C 2897..2901 CDD:409562
Ig strand E 2920..2924 CDD:409562
Ig strand F 2934..2939 CDD:409562
Ig strand G 2947..2950 CDD:409562
I-set 2966..3046 CDD:400151
Ig strand B 2976..2980 CDD:409353
Ig strand C 2989..2993 CDD:409353
Ig strand E 3012..3016 CDD:409353
Ig strand F 3026..3031 CDD:409353
I-set 3050..3141 CDD:400151
Ig strand B 3071..3075 CDD:409353
Ig strand C 3084..3088 CDD:409353
Ig strand E 3107..3111 CDD:409353
Ig strand F 3121..3126 CDD:409353
Ig strand G 3134..3137 CDD:409353
Ig 3145..3233 CDD:472250
Ig strand B 3163..3167 CDD:409353
Ig strand C 3176..3180 CDD:409353
Ig strand E 3199..3203 CDD:409353
Ig strand F 3213..3218 CDD:409353
Ig_3 3236..3315 CDD:464046
Ig 3347..3422 CDD:472250
Ig strand B 3352..3356 CDD:409353
Ig strand C 3365..3369 CDD:409353
Ig strand E 3389..3392 CDD:409353
Ig strand F 3402..3407 CDD:409353
Ig 3436..3511 CDD:472250
Ig strand B 3445..3449 CDD:409544
Ig strand C 3458..3462 CDD:409544
Ig strand E 3476..3481 CDD:409544
Ig strand F 3491..3496 CDD:409544
Ig strand G 3504..3507 CDD:409544
Ig 3529..3602 CDD:472250
Ig strand B 3534..3538 CDD:409353
Ig strand C 3547..3551 CDD:409353
Ig strand E 3568..3572 CDD:409353
Ig strand F 3582..3587 CDD:409353
Ig 3614..3695 CDD:472250
Ig strand B 3625..3629 CDD:409394
Ig strand C 3638..3642 CDD:409394
Ig strand E 3661..3665 CDD:409394
Ig strand F 3675..3680 CDD:409394
Ig strand G 3688..3691 CDD:409394
I-set 3699..3786 CDD:400151
Ig strand B 3716..3720 CDD:409353
Ig strand C 3729..3733 CDD:409353
Ig strand E 3753..3756 CDD:409353
Ig strand F 3766..3771 CDD:409353
Ig strand G 3779..3782 CDD:409353
Ig 3790..3881 CDD:472250
Ig strand B 3807..3811 CDD:409490
Ig strand C 3820..3824 CDD:409490
Ig strand E 3845..3849 CDD:409490
Ig strand F 3859..3864 CDD:409490
Ig strand G 3873..3877 CDD:409490
Ig 3900..3970 CDD:472250
Ig strand B 3900..3904 CDD:409544
Ig strand C 3913..3917 CDD:409544
Ig strand E 3936..3940 CDD:409544
Ig strand F 3950..3955 CDD:409544
Ig strand G 3963..3966 CDD:409544
I-set 3974..4060 CDD:400151
Ig strand B 3991..3995 CDD:409560
Ig strand C 4004..4008 CDD:409560
Ig strand E 4026..4030 CDD:409560
Ig strand F 4040..4045 CDD:409560
Ig 4064..4151 CDD:472250
Ig strand B 4081..4085 CDD:409353
Ig strand C 4094..4098 CDD:409353
Ig strand E 4117..4121 CDD:409353
Ig strand F 4131..4136 CDD:409353
Ig strand G 4144..4147 CDD:409353
I-set 4155..4240 CDD:400151
Ig strand C 4185..4189 CDD:409353
Ig strand E 4206..4210 CDD:409353
Ig strand F 4220..4225 CDD:409353
Ig strand G 4234..4237 CDD:409353
Ig_3 4244..4318 CDD:464046
Ig 4336..4421 CDD:472250
Ig strand B 4352..4356 CDD:409544
Ig strand C 4365..4369 CDD:409544
Ig strand E 4387..4391 CDD:409544
Ig strand F 4401..4406 CDD:409544
Ig strand G 4414..4417 CDD:409544
nidG2 4423..4639 CDD:469646
FXa_inhibition 4664..4699 CDD:464251
EGF_CA 4701..4745 CDD:214542
EGF_CA 4746..4783 CDD:214542
EGF_CA 4789..4829 CDD:214542
EGF_CA 4896..4935 CDD:214542
EGF_CA 4936..4974 CDD:214542
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.