DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and iglon5

DIOPT Version :10

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:300 Identity:71/300 - (23%)
Similarity:124/300 - (41%) Gaps:30/300 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAALTAVAW--ANHHESLSLSPAEHSVVRYTNESLIVQCRSPDPKVELHWKSPKGEIIR-----E 67
            ||.|.|:.|  .:..::........::.....||::::|:..:......|.:....:..     .
Zfish    10 LALLLALLWKGPSGAQAAEFGHLPDNITVLEGESVVLRCKIDEEVTHKAWLNRSNILFTGTDKWS 74

  Fly    68 HKGRIHIEQTSTEQLKIVFAHIALADKGNWSCE-AADGSLHSKSFDLIVYQKITFTENATVMTVK 131
            ...|:.:|..:.....|....:.:||:|.::|. .|.....:....|||.........:...:|.
Zfish    75 LDSRVSLENNNNSDFSIRIERVMVADEGPYTCSFQARNKPRTAHVYLIVQVPARIVNISQDKSVN 139

  Fly   132 EGEKATILCEVKGEPQPNVTWHFNGQPISAGAADDSKFRILADG--LLINKVTQNDTGEYACRAY 194
            |||...:.|...|.|:|.:||            .|.|:.:|.:|  |.|.::.::...::.|   
Zfish   140 EGEDVNLFCLAVGRPEPTITW------------KDFKYGLLNEGEFLEITEIKRHQAEDFEC--- 189

  Fly   195 QVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPPANFTWYRKHNK-L 258
            ..|:..:....|.|.:.:.:.||.:.   |....|.:..||.|.|||:|.|.|:|.|||...: :
Zfish   190 ITNNGVAPPDTRKVKVTVNYPPIITD---VKNMPAQVGKTAILRCEAMAVPTASFEWYRDDRRPV 251

  Fly   259 HSNNRLYTIQSDSYWSSLTIHVLNTSAFDNYRCRARNDLG 298
            .|:|.| .|:::...|.|....:....|.||.|.|.|.||
Zfish   252 ESDNTL-KIKNEKTRSLLLFTNVTEKHFGNYTCFASNRLG 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 13/87 (15%)
IgI_Twitchin_like 120..208 CDD:409541 19/89 (21%)
Ig strand A 120..123 CDD:409541 0/2 (0%)
Ig strand A' 127..131 CDD:409541 0/3 (0%)
Ig strand B 134..141 CDD:409541 1/6 (17%)
Ig strand C 149..154 CDD:409541 2/4 (50%)
Ig strand C' 156..159 CDD:409541 0/2 (0%)
Ig strand D 165..170 CDD:409541 2/4 (50%)
Ig strand E 173..178 CDD:409541 2/6 (33%)
Ig strand F 187..195 CDD:409541 1/7 (14%)
Ig strand G 198..208 CDD:409541 1/9 (11%)
IG_like 228..307 CDD:214653 27/71 (38%)
Ig strand B 235..239 CDD:409353 2/3 (67%)
Ig strand C 248..252 CDD:409353 1/3 (33%)
Ig strand E 274..278 CDD:409353 2/3 (67%)
Ig strand F 288..293 CDD:409353 3/4 (75%)
FN3 312..415 CDD:238020
iglon5NP_001017775.2 Ig 35..123 CDD:472250 13/87 (15%)
Ig strand B 44..48 CDD:409353 0/3 (0%)
Ig strand C 56..60 CDD:409353 0/3 (0%)
Ig strand E 89..93 CDD:409353 1/3 (33%)
Ig strand F 103..108 CDD:409353 1/4 (25%)
Ig strand G 116..119 CDD:409353 0/2 (0%)
Ig 122..207 CDD:472250 22/99 (22%)
Ig strand B 144..148 CDD:409353 0/3 (0%)
Ig strand C 157..161 CDD:409353 2/15 (13%)
Ig strand E 172..176 CDD:409353 1/3 (33%)
Ig strand F 186..191 CDD:409353 1/7 (14%)
Ig strand G 200..203 CDD:409353 1/2 (50%)
Ig_3 210..287 CDD:464046 28/80 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.