DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and opcml

DIOPT Version :10

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:295 Identity:73/295 - (24%)
Similarity:118/295 - (40%) Gaps:64/295 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LTAVAWANHHESLSLSPAEHSVVRYT-NESLIVQCRSPDPKVELHWKSPKGEIIREHKGRIHIEQ 76
            ::.|||.|           .:.:.:| ||..     |.||:|.|                   ..
Zfish    60 VSRVAWLN-----------RTTILFTGNEKW-----SLDPRVVL-------------------LN 89

  Fly    77 TSTEQLKIVFAHIALADKGNWSCE-AADGSLHSKSFDLIVYQKITFTENATVMTVKEGEKATILC 140
            |:..:..|...::.|.|:|.:.|. ..:....|....|||.........:|.::|.||...:::|
Zfish    90 TAVNEYSIKILNVNLYDEGPYVCSILTNKKPESTKVHLIVQVPARIVNVSTDVSVNEGSNVSLMC 154

  Fly   141 EVKGEPQPNVTWHFNGQPISAGAADDSKFRILADGLLINK--VTQNDTGEYACRAYQVNSIASDM 203
            ...|.|:|::.|.|..   |.|.      ||:.:|..:..  :|::.:|.|.|  ...|.| |..
Zfish   155 LAIGRPEPSILWKFRS---SKGN------RIVTEGEYVEMTGITKDMSGSYDC--ITSNDI-SPP 207

  Fly   204 QERTVLMKIEHKPIWSKTPFVSLKYAYINGTA-----TLMCEALAEPPANFTWYRKHNKLHSNNR 263
            ..|||.:.:.:.|:.|:        |...|||     .|.|||.|.|.|:|.|::...::.:...
Zfish   208 DVRTVQVTVNYPPVISR--------ARSTGTAVGQKGVLWCEASAVPLADFQWFKGERRILNGFN 264

  Fly   264 LYTIQSDSYWSSLTIHVLNTSAFDNYRCRARNDLG 298
            ...|::....|.||...::...:.||.|.|.|.||
Zfish   265 GVKIENKGKQSMLTFFNVSEEDYGNYTCVAINTLG 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 16/83 (19%)
IgI_Twitchin_like 120..208 CDD:409541 23/89 (26%)
Ig strand A 120..123 CDD:409541 0/2 (0%)
Ig strand A' 127..131 CDD:409541 0/3 (0%)
Ig strand B 134..141 CDD:409541 0/6 (0%)
Ig strand C 149..154 CDD:409541 1/4 (25%)
Ig strand C' 156..159 CDD:409541 0/2 (0%)
Ig strand D 165..170 CDD:409541 0/4 (0%)
Ig strand E 173..178 CDD:409541 1/4 (25%)
Ig strand F 187..195 CDD:409541 3/7 (43%)
Ig strand G 198..208 CDD:409541 3/9 (33%)
IG_like 228..307 CDD:214653 24/76 (32%)
Ig strand B 235..239 CDD:409353 2/8 (25%)
Ig strand C 248..252 CDD:409353 1/3 (33%)
Ig strand E 274..278 CDD:409353 2/3 (67%)
Ig strand F 288..293 CDD:409353 3/4 (75%)
FN3 312..415 CDD:238020
opcmlNP_001005580.1 Ig 41..129 CDD:472250 20/103 (19%)
Ig strand B 50..54 CDD:409353
Ig strand C 62..66 CDD:409353 2/3 (67%)
Ig strand E 95..99 CDD:409353 1/3 (33%)
Ig strand F 109..114 CDD:409353 1/4 (25%)
Ig strand G 122..125 CDD:409353 1/2 (50%)
Ig 128..214 CDD:472250 27/97 (28%)
Ig strand B 150..154 CDD:409353 0/3 (0%)
Ig strand C 163..167 CDD:409353 0/3 (0%)
Ig strand E 181..185 CDD:409353 0/3 (0%)
Ig strand F 195..200 CDD:409353 2/6 (33%)
Ig 220..308 CDD:472250 26/88 (30%)
Ig strand B 236..240 CDD:409353 1/3 (33%)
Ig strand C 249..253 CDD:409353 1/3 (33%)
Ig strand E 275..279 CDD:409353 2/3 (67%)
Ig strand F 289..294 CDD:409353 3/4 (75%)
Ig strand G 302..305 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.