DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and Opcml

DIOPT Version :10

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_006510497.1 Gene:Opcml / 330908 MGIID:97397 Length:354 Species:Mus musculus


Alignment Length:336 Identity:84/336 - (25%)
Similarity:130/336 - (38%) Gaps:69/336 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LTAVAWANHHESLSLSPAEHSVVRYT-NESLIVQCRSPDPKVELHWKSPKGEIIREHKGRIHIEQ 76
            :|.|||.|           .|.:.|. |:..     |.||:|                  |.:..
Mouse    63 VTRVAWLN-----------RSTILYAGNDKW-----SIDPRV------------------IILVN 93

  Fly    77 TSTEQLKIVFAHIALADKGNWSCEA-ADGSLHSKSFDLIVYQKITFTENATVMTVKEGEKATILC 140
            |.| |..|:..::.:.|:|.::|.. .|....:....|||.........::.:||.||...|:||
Mouse    94 TPT-QYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNEGSSVTLLC 157

  Fly   141 EVKGEPQPNVTWHFNGQPISAGAADDSKFRILADGLLINKVTQNDTGEYACRAYQVNSIASDMQE 205
            ...|.|:|.|||.........|...:.::      |.|:.:.::.:|||.|.|  :|.:|:. ..
Mouse   158 LAIGRPEPTVTWRHLSVKEGQGFVSEDEY------LEISDIKRDQSGEYECSA--LNDVAAP-DV 213

  Fly   206 RTVLMKIEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPPANFTWYRKHNKLHSNNRLYTIQSD 270
            |.|.:.:.:.|..||.....:.   :.....|.|||.|.|.|.|.|:::..:|.:......|::.
Mouse   214 RKVKITVNYPPYISKAKNTGVS---VGQKGILSCEASAVPMAEFQWFKEDTRLATGLDGVRIENK 275

  Fly   271 SYWSSLTIHVLNTSAFDNYRCRARNDLGTIERTTRLEQGEKPPSPANFQLRGFNSNTFDVVLSAP 335
            ...|:||...::...:.||.|.|.|.||....:..|.  |..||                  ||.
Mouse   276 GRISTLTFFNVSEKDYGNYTCVATNKLGNTNASITLY--EISPS------------------SAV 320

  Fly   336 RGPPDSPMGVN 346
            .||.....|||
Mouse   321 AGPGAVIDGVN 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 17/83 (20%)
IgI_Twitchin_like 120..208 CDD:409541 24/87 (28%)
Ig strand A 120..123 CDD:409541 0/2 (0%)
Ig strand A' 127..131 CDD:409541 1/3 (33%)
Ig strand B 134..141 CDD:409541 2/6 (33%)
Ig strand C 149..154 CDD:409541 3/4 (75%)
Ig strand C' 156..159 CDD:409541 0/2 (0%)
Ig strand D 165..170 CDD:409541 0/4 (0%)
Ig strand E 173..178 CDD:409541 1/4 (25%)
Ig strand F 187..195 CDD:409541 5/7 (71%)
Ig strand G 198..208 CDD:409541 2/9 (22%)
IG_like 228..307 CDD:214653 21/78 (27%)
Ig strand B 235..239 CDD:409353 1/3 (33%)
Ig strand C 248..252 CDD:409353 1/3 (33%)
Ig strand E 274..278 CDD:409353 2/3 (67%)
Ig strand F 288..293 CDD:409353 3/4 (75%)
FN3 312..415 CDD:238020 9/35 (26%)
OpcmlXP_006510497.1 Ig 44..132 CDD:472250 22/103 (21%)
Ig strand B 53..57 CDD:409353
Ig strand C 65..69 CDD:409353 2/3 (67%)
Ig strand E 98..102 CDD:409353 1/3 (33%)
Ig strand F 112..117 CDD:409353 1/4 (25%)
Ig strand G 125..128 CDD:409353 0/2 (0%)
Ig_3 135..206 CDD:464046 21/78 (27%)
Ig 224..312 CDD:472250 24/90 (27%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 1/3 (33%)
Ig strand E 279..283 CDD:409353 2/3 (67%)
Ig strand F 293..298 CDD:409353 3/4 (75%)
Ig strand G 306..309 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.