DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and DIP-alpha

DIOPT Version :10

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster


Alignment Length:399 Identity:78/399 - (19%)
Similarity:154/399 - (38%) Gaps:97/399 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AEHSVVRYTNESLIVQCRSPDPKVEL-HWKSPKGEIIREHKGRIHIEQTSTEQLKIVFAHIALAD 93
            |:...::..:|::|..    :|:|.: |        :.::...:||:..|.|            |
  Fly    78 ADTKAIQAIHENVITH----NPRVTVSH--------LDQNTWNLHIKAVSEE------------D 118

  Fly    94 KGNWSCEAADGSLHSK--SFDLIVYQKITFTENATVMTVKEGEKATILCEVKGEPQPNVTWHFNG 156
            :|.:.|:.....:.|:  ..|:::.......:.::.:.|.||....:.|..:|.|:|.|||.   
  Fly   119 RGGYMCQLNTDPMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTCRARGYPEPIVTWR--- 180

  Fly   157 QPISAGAADDSKFRILADG--------------LLINKVTQNDTGEYACRAYQVNSIASDMQERT 207
                   .:|....:|.|.              |.::|:::|:.|.|.|.|  .|.:...:.:| 
  Fly   181 -------REDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIA--SNGVPPSVSKR- 235

  Fly   208 VLMKIEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPPANFTWYRKHNKLHSNNRLYTIQSDS- 271
            :.:.|...|: .:.| ..|..|.:.....:.|...|.|.:...|.:...::...:..|.:|..| 
  Fly   236 ISLSIHFHPV-IQVP-NQLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVTSGKYHVQESSQ 298

  Fly   272 --YWSSLTIHVLNTSAFD--NYRCRARNDLGTIERTTRLEQGEKP---PSPANFQLRG------F 323
              |.:.:::.|......|  :|||.|:|.||.::.:.||.:...|   .:|.|...:|      .
  Fly   299 SMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYEIPGPNRNKNPLNGGGKGGGAGGSL 363

  Fly   324 NSNTFDVV-----LSAPRGPPDSPMGVNGFRIEYMTEMEFKTDAGKWTNARRKDYAFEEGATFLL 383
            :::..|::     :.....|.|.       .::|.:..:|:.:.|             ||..  |
  Fly   364 DADANDILKQKQQVKVTYQPEDE-------ELQYGSVEDFEAEGG-------------EGGG--L 406

  Fly   384 TNLEPDTVY 392
            |.|.|...|
  Fly   407 TPLSPHVYY 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 14/84 (17%)
IgI_Twitchin_like 120..208 CDD:409541 22/101 (22%)
Ig strand A 120..123 CDD:409541 0/2 (0%)
Ig strand A' 127..131 CDD:409541 0/3 (0%)
Ig strand B 134..141 CDD:409541 0/6 (0%)
Ig strand C 149..154 CDD:409541 3/4 (75%)
Ig strand C' 156..159 CDD:409541 0/2 (0%)
Ig strand D 165..170 CDD:409541 1/4 (25%)
Ig strand E 173..178 CDD:409541 2/18 (11%)
Ig strand F 187..195 CDD:409541 4/7 (57%)
Ig strand G 198..208 CDD:409541 1/9 (11%)
IG_like 228..307 CDD:214653 19/83 (23%)
Ig strand B 235..239 CDD:409353 0/3 (0%)
Ig strand C 248..252 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 0/3 (0%)
Ig strand F 288..293 CDD:409353 3/4 (75%)
FN3 312..415 CDD:238020 17/95 (18%)
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 13/74 (18%)
Ig strand B 59..63 CDD:409353
Ig strand C 72..76 CDD:409353
Ig strand E 103..111 CDD:409353 0/7 (0%)
Ig 152..240 CDD:472250 22/100 (22%)
Ig strand B 163..167 CDD:409275 0/3 (0%)
Ig strand C 176..180 CDD:409275 2/3 (67%)
Ig strand E 205..209 CDD:409275 1/3 (33%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 1/3 (33%)
Ig 244..337 CDD:472250 21/94 (22%)
Ig strand B 261..265 CDD:409353 0/3 (0%)
Ig strand C 274..278 CDD:409353 0/3 (0%)
Ig strand E 305..309 CDD:409353 0/3 (0%)
Ig strand F 319..324 CDD:409353 3/4 (75%)
Ig strand G 332..335 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.