DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and Iglon5

DIOPT Version :10

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001419161.1 Gene:Iglon5 / 308557 RGDID:1305344 Length:336 Species:Rattus norvegicus


Alignment Length:329 Identity:84/329 - (25%)
Similarity:124/329 - (37%) Gaps:92/329 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LTAVAWANHHESLSLSPAEHSVVRYTNESLIVQCRSPDPKVELHWKSPKGEIIREHKGRIHIEQT 77
            :|.|||.|....|.....     |:|:          ||:|.|...:|                 
  Rat    60 VTRVAWLNRSNILYAGND-----RWTS----------DPRVRLLINTP----------------- 92

  Fly    78 STEQLKIVFAHIALADKGNWSCEAADGSLHSKSFD-----------LIVYQKITFTENATVMTVK 131
              |:..|:...:.|.|:|.::|          ||.           |||:........::.:.|.
  Rat    93 --EEFSILITQVGLGDEGLYTC----------SFQTRHQPYTTQVYLIVHVPARIVNISSPVAVN 145

  Fly   132 EGEKATILCEVKGEPQPNVTWHFNGQPISAGAADDSKFRILADG-------LLINKVTQNDTGEY 189
            ||....:||...|.|:|.|||                 |.|.||       |.|:.:.:...|||
  Rat   146 EGGNVNLLCLAVGRPEPTVTW-----------------RQLRDGFTSEGEILEISDIQRGQAGEY 193

  Fly   190 ACRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPPANFTWYRK 254
            .|..:  |.:.|....|.||:.:.:.|  :.|...|.:.| :...|.|.|||:|.|||:|.||:.
  Rat   194 ECVTH--NGVNSAPDSRRVLVTVNYPP--TITDVTSARTA-LGRAALLRCEAMAVPPADFQWYKD 253

  Fly   255 HNKLHSNN-RLYTIQSDSYWSSLTIHVLNTSAFDNYRCRARNDLGTIERTTRL-------EQGEK 311
            ...|.|.: ....:|::...|.|....::...:.||.|||.|.||....:.||       ....:
  Rat   254 DRLLSSGSAEGLKVQTERTRSMLLFANVSARHYGNYTCRAANRLGASSASMRLLRPGSLENSAPR 318

  Fly   312 PPSP 315
            ||.|
  Rat   319 PPGP 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 16/92 (17%)
IgI_Twitchin_like 120..208 CDD:409541 24/94 (26%)
Ig strand A 120..123 CDD:409541 0/2 (0%)
Ig strand A' 127..131 CDD:409541 0/3 (0%)
Ig strand B 134..141 CDD:409541 1/6 (17%)
Ig strand C 149..154 CDD:409541 3/4 (75%)
Ig strand C' 156..159 CDD:409541 0/2 (0%)
Ig strand D 165..170 CDD:409541 0/4 (0%)
Ig strand E 173..178 CDD:409541 3/11 (27%)
Ig strand F 187..195 CDD:409541 4/7 (57%)
Ig strand G 198..208 CDD:409541 2/9 (22%)
IG_like 228..307 CDD:214653 28/86 (33%)
Ig strand B 235..239 CDD:409353 2/3 (67%)
Ig strand C 248..252 CDD:409353 1/3 (33%)
Ig strand E 274..278 CDD:409353 2/3 (67%)
Ig strand F 288..293 CDD:409353 3/4 (75%)
FN3 312..415 CDD:238020 3/4 (75%)
Iglon5NP_001419161.1 Ig 41..129 CDD:472250 22/112 (20%)
Ig strand B 50..54 CDD:409382
Ig strand C 62..66 CDD:409382 2/3 (67%)
Ig strand E 95..99 CDD:409382 1/3 (33%)
Ig strand F 109..114 CDD:409382 1/14 (7%)
Ig strand G 122..125 CDD:409382 0/2 (0%)
Ig_3 134..199 CDD:464046 21/83 (25%)
Ig_3 217..295 CDD:464046 26/80 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.