DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and Igsf9

DIOPT Version :10

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001100667.1 Gene:Igsf9 / 304982 RGDID:1304566 Length:1179 Species:Rattus norvegicus


Alignment Length:536 Identity:106/536 - (19%)
Similarity:160/536 - (29%) Gaps:210/536 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SLSLS--------PAEHSVVRYTNESLIVQC--RSPDPKVELH---W---------------KSP 60
            ||.||        |...|||....||.::.|  ..|..:..||   |               .||
  Rat    11 SLILSQGADGRRKPEVVSVVGRAGESAVLGCDLLPPAGRPPLHVIEWLRFGFLLPIFIQFGLYSP 75

  Fly    61 KGEIIREHKGRIHIEQTSTEQLKIVFAHIALADKGNWSCEAADGSLHSKSFDLIVYQKITFTENA 125
            :  |..::.||:.::..::.|::    .:.:.|:|.:.|.......||...|......:..|.|:
  Rat    76 R--IDPDYVGRVRLQTGASLQIE----GLRVEDQGWYECRVLFLDQHSPEQDFANGSWVHLTVNS 134

  Fly   126 ---------TVMTVKEGEKATILCEVKGEPQPNVTWHFNGQPISAGAADDSKFRILADGLLINKV 181
                     .|:.|||.|..|:.|...|.|||.|||.|.||.:..|   ..:.::....|.|.:|
  Rat   135 PPQFQETPPLVLEVKELEAVTLRCVALGSPQPYVTWKFRGQDLGKG---QGQVQVRNGTLWIRRV 196

  Fly   182 TQNDTGEYACR--------------------------------------------AYQVNSIASD 202
            .:...|:|.|:                                            ||..|...|.
  Rat   197 ERGSAGDYTCQASSTEGSVTHTTQLLVLGPPVIVVPPNNNTVNASQDVSLACRAEAYPANLTYSW 261

  Fly   203 MQERTVLMKIE------------------------------------HKPIWSKTPFVSLKYAY- 230
            .|:|..:..|.                                    |.|  |.:.::::.|.. 
  Rat   262 FQDRINVFHISRLQSRVRILVDGSLWLQATQPDDAGHYTCVPSNGFPHPP--SASAYLTVLYPAQ 324

  Fly   231 -----------INGTATLMCEALAEPPANFTWYRKHNKLHSNNRLYTIQSDSY--WS-----SLT 277
                       |.....:.|...|.||..|..:.|..:        .:|.|.:  ||     ||.
  Rat   325 VTVMPPETPLPIGMRGVIRCPVRANPPLLFVTWTKDGQ--------ALQLDKFPGWSLGPEGSLV 381

  Fly   278 IHVLNTSAFDNYRCRARNDLGTIERTTRLEQGEKPPSPANFQLRGFNSNTFDVVLSAPRGPPDSP 342
            |.:.|..|...|.|...|.|||        .|..|.:              .|:|.||....|.|
  Rat   382 IALGNEDALGEYSCTPYNSLGT--------AGSSPVT--------------RVLLKAPPAFIDQP 424

  Fly   343 MGVNGFRIEYMTEMEFKTDAGKWTNARRKDYAFEEGATFLL---TNLEPDTVYLVRAASRNLAGF 404
                                       :::|..|.|...|:   ...:|..:.......|.|.|.
  Rat   425 ---------------------------KEEYFQEVGRDLLIPCSARGDPPPIVSWAKVGRGLQGQ 462

  Fly   405 SDFTKVEKYKTLSLEP 420
            :   :|:...:|.|.|
  Rat   463 A---QVDSNNSLILRP 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 22/101 (22%)
IgI_Twitchin_like 120..208 CDD:409541 32/140 (23%)
Ig strand A 120..123 CDD:409541 0/2 (0%)
Ig strand A' 127..131 CDD:409541 1/3 (33%)
Ig strand B 134..141 CDD:409541 2/6 (33%)
Ig strand C 149..154 CDD:409541 3/4 (75%)
Ig strand C' 156..159 CDD:409541 2/2 (100%)
Ig strand D 165..170 CDD:409541 0/4 (0%)
Ig strand E 173..178 CDD:409541 1/4 (25%)
Ig strand F 187..195 CDD:409541 4/51 (8%)
Ig strand G 198..208 CDD:409541 3/9 (33%)
IG_like 228..307 CDD:214653 23/97 (24%)
Ig strand B 235..239 CDD:409353 0/3 (0%)
Ig strand C 248..252 CDD:409353 1/3 (33%)
Ig strand E 274..278 CDD:409353 3/8 (38%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
FN3 312..415 CDD:238020 16/105 (15%)
Igsf9NP_001100667.1 IG_like 28..110 CDD:214653 19/87 (22%)
Ig strand B 37..41 CDD:409353 0/3 (0%)
Ig strand C 54..58 CDD:409353 0/3 (0%)
Ig strand E 91..95 CDD:409353 0/3 (0%)
IG_like 143..223 CDD:214653 24/82 (29%)
Ig strand B 154..158 CDD:409353 1/3 (33%)
Ig strand C 167..171 CDD:409353 2/3 (67%)
Ig strand E 189..193 CDD:409353 1/3 (33%)
Ig strand F 203..208 CDD:409353 2/4 (50%)
Ig strand G 216..219 CDD:409353 0/2 (0%)
Ig_3 226..305 CDD:464046 7/78 (9%)
Ig 322..407 CDD:472250 23/100 (23%)
Ig strand B 333..344 CDD:409353 1/10 (10%)
Ig strand C 353..358 CDD:409353 1/4 (25%)
Ig strand E 378..382 CDD:409353 2/3 (67%)
Ig strand F 392..397 CDD:409353 2/4 (50%)
Ig 418..503 CDD:472250 14/88 (16%)
Ig strand B 436..440 CDD:409353 1/3 (33%)
Ig strand C 449..453 CDD:409353 0/3 (0%)
Ig strand E 469..473 CDD:409353 1/3 (33%)
Ig strand F 483..488 CDD:409353
Ig strand G 496..499 CDD:409353
FN3 508..599 CDD:238020
FN3 625..715 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 766..807
PHA03247 <777..1062 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 819..846
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 869..895
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 942..979
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1016..1079
PDZ-binding. /evidence=ECO:0000250 1177..1179
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.