DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and Igsf9b

DIOPT Version :10

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_011240777.1 Gene:Igsf9b / 235086 MGIID:2685354 Length:1443 Species:Mus musculus


Alignment Length:439 Identity:97/439 - (22%)
Similarity:160/439 - (36%) Gaps:96/439 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LSPAEHSVVRYTNESLIVQCRSPDPKVEL----HWKSPKGEIIREHKGRIHIEQTSTEQLKIVFA 87
            :||.|:..|..:.::|:. ||:......|    :|:........:.|.|:.|....|    ::..
Mouse   234 VSPPENITVNISQDALLT-CRAEAYPGNLTYTWYWQDENVYFQNDLKLRVRILIDGT----LIIF 293

  Fly    88 HIALADKGNWSCEAAD--GSLHSKSFDLIVYQKITFTENATVMTVKEGEKATILCEVKGEPQPNV 150
            .:...|.|.::|..::  |...|.|..|.|...........|:.|..|....|.|.|..||...|
Mouse   294 RVKPEDAGKYTCVPSNSLGRSPSASAYLTVQYPARVLNMPPVIYVPVGIHGYIRCPVDAEPPATV 358

  Fly   151 T-WHFNGQPISAGAADDSKFRILADG-LLINKVTQNDTGEYACRAYQVNSIASDMQERTVLMKIE 213
            . |:.:|:|:.  ...:..:.::.|| :.|.:.|:...|.|.|..|  |::.:..|.....:.::
Mouse   359 VKWNKDGRPLQ--VEKNLGWTLMEDGSIRIEEATEEALGTYTCVPY--NTLGTMGQSAPARLVLK 419

  Fly   214 HKPIWSKTPFVSLKYAYINGTATLM-CEALAEPPANFTWYR-------KHNKLHSNNRLYTIQSD 270
            ..|.::..|  ..:|....|...|: |.|..:|....||.:       |||.|.|          
Mouse   420 DPPYFTVLP--GWEYRQEAGRELLIPCAAAGDPFPVITWRKVGKPSRSKHNALPS---------- 472

  Fly   271 SYWSSLTIHVLNTSAFDNYRCRARNDLGTIERTTRLEQ-GEKPPSPANFQLR------------- 321
               .||....|:......:.|.|.|.:.:|..:|.|.. |..|.:|.:.::.             
Mouse   473 ---GSLQFRALSKEDHGEWECVATNVVTSITASTHLTVIGTSPHAPGSVRVHVSMTTANVSWEPG 534

  Fly   322 --GFNSNTFDV-----VLSAPRGPPDSPMGVNGFRIEYMTEMEFKTDAGKWTNARRKDYAFEEGA 379
              |....||.|     :..|..||.|                        |.:     .:...|.
Mouse   535 YDGGYEQTFSVWYGPLMKRAQFGPHD------------------------WLS-----LSVPPGP 570

  Fly   380 TFLLT-NLEPDTVYLVRAASRNLAGFSDFTKVEKYKTLSL-----EPRV 422
            ::||. :|||:|.|.....::|..|.|.|::|....||:.     ||.|
Mouse   571 SWLLVDSLEPETAYQFSVLAQNRLGTSAFSEVVTVNTLAFPVTTPEPLV 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 17/87 (20%)
IgI_Twitchin_like 120..208 CDD:409541 22/89 (25%)
Ig strand A 120..123 CDD:409541 0/2 (0%)
Ig strand A' 127..131 CDD:409541 1/3 (33%)
Ig strand B 134..141 CDD:409541 1/6 (17%)
Ig strand C 149..154 CDD:409541 2/5 (40%)
Ig strand C' 156..159 CDD:409541 1/2 (50%)
Ig strand D 165..170 CDD:409541 0/4 (0%)
Ig strand E 173..178 CDD:409541 2/5 (40%)
Ig strand F 187..195 CDD:409541 3/7 (43%)
Ig strand G 198..208 CDD:409541 1/9 (11%)
IG_like 228..307 CDD:214653 21/86 (24%)
Ig strand B 235..239 CDD:409353 1/4 (25%)
Ig strand C 248..252 CDD:409353 1/3 (33%)
Ig strand E 274..278 CDD:409353 2/3 (67%)
Ig strand F 288..293 CDD:409353 1/4 (25%)
FN3 312..415 CDD:238020 24/123 (20%)
Igsf9bXP_011240777.1 Ig 43..117 CDD:409353
Ig strand B 43..47 CDD:409353
Ig strand C 61..65 CDD:409353
Ig strand E 98..102 CDD:409353
Ig strand F 112..117 CDD:409353
I-set 141..227 CDD:400151
Ig strand B 159..163 CDD:409353
Ig strand C 172..176 CDD:409353
Ig strand E 193..197 CDD:409353
Ig strand F 207..212 CDD:409353
Ig strand G 220..223 CDD:409353
Ig_3 230..309 CDD:464046 16/79 (20%)
Ig 338..412 CDD:472250 21/77 (27%)
Ig strand B 344..348 CDD:409353 1/3 (33%)
Ig strand C 357..362 CDD:409353 1/4 (25%)
Ig strand E 382..386 CDD:409353 1/3 (33%)
Ig strand F 396..401 CDD:409353 2/4 (50%)
Ig strand G 409..412 CDD:409353 1/2 (50%)
Ig 431..507 CDD:472250 22/88 (25%)
Ig strand B 440..444 CDD:409353 1/3 (33%)
Ig strand C 453..457 CDD:409353 1/3 (33%)
Ig strand E 473..477 CDD:409353 2/3 (67%)
Ig strand F 487..492 CDD:409353 1/4 (25%)
FN3 <492..>737 CDD:442628 35/157 (22%)
Ig strand G 500..503 CDD:409353 0/2 (0%)
FN3 512..607 CDD:238020 24/123 (20%)
PHA03247 <900..1248 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.