DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and IGSF5

DIOPT Version :10

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_047296655.1 Gene:IGSF5 / 150084 HGNCID:5952 Length:497 Species:Homo sapiens


Alignment Length:174 Identity:33/174 - (18%)
Similarity:55/174 - (31%) Gaps:66/174 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 KIVFAHIALADKGNWSCEAADGSLHSKSFDLIVYQKITFTENATVMTVKEGEKATILCEVKGEPQ 147
            :::..::..:|.||..|...:..||..::..:......|..:.. :.|.|.|.    |||...|.
Human   197 EMIIHNVEPSDSGNIRCSLQNSRLHGSAYLTV
QVMGELFIPSVN-LVVAENEP----CEVTCLPS 256

  Fly   148 -----PNVTWHFNGQPISAGAADDSKFRILADGLLINKVTQNDTGEYACRAYQVNSIASDMQERT 207
                 |:::|..                    |||::.           .:|......||:|...
Human   257 HWTRLPDISWEL--------------------GLLVSH-----------SSYYFVPEPSDLQSAV 290

  Fly   208 VLMKIEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPPANFTW 251
            .::.:        ||       ..|||.|  |.|        ||
Human   291 SILAL--------TP-------QSNGTLT--CVA--------T
W 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 6/31 (19%)
IgI_Twitchin_like 120..208 CDD:409541 17/92 (18%)
Ig strand A 120..123 CDD:409541 1/2 (50%)
Ig strand A' 127..131 CDD:409541 0/3 (0%)
Ig strand B 134..141 CDD:409541 1/6 (17%)
Ig strand C 149..154 CDD:409541 1/4 (25%)
Ig strand C' 156..159 CDD:409541 0/2 (0%)
Ig strand D 165..170 CDD:409541 0/4 (0%)
Ig strand E 173..178 CDD:409541 2/4 (50%)
Ig strand F 187..195 CDD:409541 0/7 (0%)
Ig strand G 198..208 CDD:409541 3/9 (33%)
IG_like 228..307 CDD:214653 8/24 (33%)
Ig strand B 235..239 CDD:409353 1/3 (33%)
Ig strand C 248..252 CDD:409353 2/4 (50%)
Ig strand E 274..278 CDD:409353
Ig strand F 288..293 CDD:409353
FN3 312..415 CDD:238020
IGSF5XP_047296655.1 IG_like 135..228 CDD:214653 6/30 (20%)
Ig_3 233..308 CDD:464046 25/135 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.