DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Klk12

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_081373.1 Gene:Klk12 / 69511 MGIID:1916761 Length:247 Species:Mus musculus


Alignment Length:257 Identity:93/257 - (36%)
Similarity:131/257 - (50%) Gaps:44/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 CFCGTPNVNR--IVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQI 128
            |..|....:|  |..|.:...|..||...|..|::   |.|||.|::.::|||||||    ||:.
Mouse    10 CAVGLSQADREKIYNGVECVKNSQPWQVGLFHGKY---LRCGGVLVDRKWVLTAAHC----RDKY 67

  Fly   129 TIR-----LLQIDRSSRDPGIVRKVVQTTVHPNYDP--NRIVNDVALLKLESPVPLTGNMRPVCL 186
            .:|     |.::|.:.:    :|....:..||:|..  ....:|:.||:|..|:.||..:|||.|
Mouse    68 VVRLGEHSLTKLDWTEQ----LRHTTFSITHPSYQGAYQNHEHDLRLLRLNRPIHLTRAVRPVAL 128

  Fly   187 PEANHNFDGKTAVVAGWGLIKEGGVTSN--------YLQEVNVPVITNAQCRQTRYKDKIAEVML 243
            |.:... .|....|:|||       |:|        .||.:|:..::|..||.. :..::.|.||
Mouse   129 PSSCVT-TGAMCHVSGWG-------TTNKPWDPFPDRLQCLNLSTVSNETCRAV-FPGRVTENML 184

  Fly   244 CAGLVQQGGKDACQGDSGGPLIVNEGRYKLAGVVSFGY--GCAQKNAPGVYARVSKFLDWIR 303
            |||  .:.|||||||||||||:...   .|.|:||:|.  .|.||..||||.:|.|:.||||
Mouse   185 CAG--GEAGKDACQGDSGGPLVCGG---VLQGLVSWGSVGPCGQKGIPGVYTKVCKYTDWIR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 88/245 (36%)
Tryp_SPc 76..305 CDD:238113 90/245 (37%)
Klk12NP_081373.1 Tryp_SPc 21..240 CDD:214473 87/243 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.