DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3355 and 2210010C04Rik

Sequence 1:NP_608848.1 Gene:CG3355 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_075822.3 Gene:2210010C04Rik MGIID:1914623 Length:247 Species:Mus musculus

Alignment Length:241 Identity:93/242 (38%)
Similarity:143/242 (59%) Gaps:25/242 (10%)


  Fly    74 NRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIRLLQIDRS 138
            ::||||...:.|..|:...|..|.|    ||||||||.::|::||||.   :.:|.:||.:.:..
Mouse    23 DKIVGGYTCQRNALPYQVSLNSGYH----FCGGSLINSQWVVSAAHCY---KSRIQVRLGEHNID 80

  Fly   139 SRDPG----IVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDGKTAV 199
            :.:.|    ...|:::   ||||:.|...||:.|:||::...|...:..|.||.:..: .|...:
Mouse    81 ALEGGEQFIDAAKIIR---HPNYNANTYNNDIMLIKLKTAATLNSRVSTVALPRSCPS-AGTRCL 141

  Fly   200 VAGWGLIKEGGVTSNY---LQEVNVPVITNAQCRQTRYKDKIAEVMLCAGLVQQGGKDACQGDSG 261
            |:|||.....|  :||   ||.::.||::::.|..: |..||...|.|.|.: :||||:||||||
Mouse   142 VSGWGNTLSSG--TNYPSLLQCLDAPVLSDSSCTSS-YPGKITSNMFCLGFL-EGGKDSCQGDSG 202

  Fly   262 GPLIVNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKNTA 307
            ||::.|.   :|.||||:||||||:..||||.:|.|:::||::..|
Mouse   203 GPVVCNG---QLQGVVSWGYGCAQRGKPGVYTKVCKYVNWIQQTIA 245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 91/234 (39%)
Tryp_SPc 76..305 CDD:238113 92/236 (39%)
2210010C04RikNP_075822.3 Tryp_SPc 24..240 CDD:214473 91/234 (39%)
Tryp_SPc 25..243 CDD:238113 92/236 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126639
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.