DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and zmp:0000001088

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_688573.1 Gene:zmp:0000001088 / 560086 ZFINID:ZDB-GENE-140106-48 Length:263 Species:Danio rerio


Alignment Length:242 Identity:99/242 - (40%)
Similarity:129/242 - (53%) Gaps:32/242 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 RIVGG--QQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIRLLQIDR 137
            |||||  ....|.||..:.|...|:|    ||||:|||..:|||||||   |..:..:|::..|.
Zfish    26 RIVGGYVPAPYSIKYIVSIQSATGQH----FCGGTLINKYWVLTAAHC---NIGEANMRIVAGDY 83

  Fly   138 SSRDPGI------VRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDGK 196
            |   .|:      .|:......||.||.:....|:.|:||:|||.|...:..|.||..    |..
Zfish    84 S---VGLYEGMEQFRRPHMLIPHPQYDRSTNNADIMLIKLQSPVYLNSYVSLVPLPRQ----DAM 141

  Fly   197 TAV-----VAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQT-RYKDKIAEVMLCAGLVQQGGKDA 255
            .||     |:|||.....|..|:.|:.|.:|:::.|.|..| .:...|.|.|:||| ...|||||
Zfish   142 VAVGRLCSVSGWGFTTSTGGISSILRTVKLPIVSTAVCNGTDSFNGNITENMICAG-YSTGGKDA 205

  Fly   256 CQGDSGGPLIVNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWI 302
            |:|||||||:. |||  :.|:||:|.|||....||||..||:|..||
Zfish   206 CKGDSGGPLVC-EGR--VYGIVSWGNGCADAQYPGVYTAVSQFRQWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 97/240 (40%)
Tryp_SPc 76..305 CDD:238113 98/241 (41%)
zmp:0000001088XP_688573.1 Tryp_SPc 26..249 CDD:214473 97/240 (40%)
Tryp_SPc 27..252 CDD:238113 98/241 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.