DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3355 and CG11836

Sequence 1:NP_608848.1 Gene:CG3355 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster

Alignment Length:292 Identity:111/293 (38%)
Similarity:161/293 (55%) Gaps:40/293 (14%)


  Fly    35 ADVVDVVDPAEQSIKAVRPPKSRNQCTAKQNCFCGTPNVN-RIVGGQQVRSNKYPWTAQLVKGRH 98
            :|..|.|:..|.|        |...|    :|.||..|.. |||||:....|:|||.|::|   :
  Fly    67 SDTEDEVEYTENS--------SLKNC----DCDCGFSNEEIRIVGGKPTGVNQYPWMARIV---Y 116

  Fly    99 YPRLFCGGSLINDRYVLTAAHCV-----------HGNRDQITIRLLQIDRSSRDPGIVRKVVQTT 152
            ..:..|||||:...|||:|||||           .|:.||        :.:|....|.|.|....
  Fly   117 DGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQ--------EITSESQAIQRAVTAVI 173

  Fly   153 VHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDGKTAVVAGWGLIKEGGVTSNYLQ 217
            .|.::||:...||:|||:|..|:..:..::|:|||..|::..|:...|.|||...|||...:.:.
  Fly   174 KHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAGRIGTVVGWGRTSEGGELPSIVN 238

  Fly   218 EVNVPVITNAQCRQTRYKD-KIAEVMLCAGLVQQGGKDACQGDSGGPLIVNEG-RYKLAGVVSFG 280
            :|.||:::..:||..|||. :|...|||||   :...|:|||||||||:::.| :|.:.|:||:|
  Fly   239 QVKVPIMSITECRNQRYKSTRITSSMLCAG---RPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWG 300

  Fly   281 YGCAQKNAPGVYARVSKFLDWIRKNTADGCYC 312
            .||.::..||||:|||||:.||:.|..:.|.|
  Fly   301 VGCGREGYPGVYSRVSKFIPWIKSNLENTCLC 332

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 96/240 (40%)
Tryp_SPc 76..305 CDD:238113 96/242 (40%)
CG11836NP_001356925.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130926058
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I2900
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24256
RoundUp 00.000 Not matched by this tool.
33.080

Return to query results.
Submit another query.