DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and CG33459

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:261 Identity:91/261 - (34%)
Similarity:118/261 - (45%) Gaps:35/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CG-TPNVNRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIR 131
            || .|...||.||........||.|.|   .::.:..||||||...:||||||||......:|:|
  Fly    29 CGQIPFRMRIFGGMDAGLVSTPWMAFL---HNHLQFLCGGSLITSEFVLTAAHCVMPTPKNLTVR 90

  Fly   132 LLQIDRSSRDPGIVRK-------VVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVC--LP 187
            |.:.|.:.:...|..|       |.:...||:| .:....|:|||||...|..|..:||:|  ||
  Fly    91 LGEYDWTRQMDSINPKHRHREYMVTRIYTHPSY-RSIAAYDIALLKLNQTVEYTVAIRPICLVLP 154

  Fly   188 EANHNF-----DGKTAVVAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQTRYKDKIAEVMLCAGL 247
            |..|.:     ..:...:.|||..|...| |..||..|:..|....|.. ||...:....:||| 
  Fly   155 ENFHEWYWLVDSVEDFTLTGWGATKTEPV-SQVLQSANLTQIDRGTCHD-RYGHSVDHTHICAG- 216

  Fly   248 VQQGGKDACQGDSGGPL---IVNEGRYKLA--GVVSFGYGCAQKNAPG--VYARVSKFLDWIRKN 305
              .....||.||||.||   :|:..||..|  |:||.|    .||..|  |:..|..|.:||.:.
  Fly   217 --SSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRG----PKNCDGVTVFTNVVSFTEWIFRT 275

  Fly   306 T 306
            |
  Fly   276 T 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 85/247 (34%)
Tryp_SPc 76..305 CDD:238113 86/249 (35%)
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 85/247 (34%)
Tryp_SPc 38..272 CDD:238113 84/246 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.