DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and AgaP_AGAP004770

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_318046.3 Gene:AgaP_AGAP004770 / 1278456 VectorBaseID:AGAP004770 Length:259 Species:Anopheles gambiae


Alignment Length:260 Identity:94/260 - (36%)
Similarity:140/260 - (53%) Gaps:31/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VRPPKS-RNQCTAKQNCFCGTPNVNRIVGGQQVRSNKYPWTAQLVK-GRHYPRLFCGGSLINDRY 113
            :.||.| .|:.|            .|||||.::.....|:.|.:.. |.|    .||||:|:.::
Mosquito    17 LEPPVSILNETT------------QRIVGGHEIDIGAAPFQASVQSHGVH----VCGGSIIHQQW 65

  Fly   114 VLTAAHCVHGNRDQITIRLLQIDRSSRDPGIVRKVVQTTVHPNYDPNRIVN-DVALLKLESPVPL 177
            ||:|.||.....:.:::|:..|..:  ..|.:..|.::..||.||...|:: ||:||:||..:..
Mosquito    66 VLSAGHCSSKEPNSLSVRVASIHHN--QGGQIVNVEESIRHPLYDEQLIIDYDVSLLRLEQCLTF 128

  Fly   178 TGNMRPVCLPEANHNF-DGKTAVVAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQTRYKDKIAEV 241
            :.|::.:.||..:..| ||...||:|||..:....:|:.|:..:||::.:|.| ||.|....|.:
Mosquito   129 SPNVQAIRLPMQDEFFQDGTVCVVSGWGATQNPVESSDRLRATDVPLVNHAVC-QTAYISAAATI 192

  Fly   242 ---MLCAGLVQQGGKDACQGDSGGPLIVNEGRYKLAGVVSFGYG-CAQKNAPGVYARVSKFLDWI 302
               |:|||.. .||:|||||||||||....   .|.||||:..| ||:.|.||||:||:....||
Mosquito   193 TDRMICAGYF-SGGRDACQGDSGGPLYYEN---TLIGVVSWRTGDCAEVNFPGVYSRVASVRAWI 253

  Fly   303  302
            Mosquito   254  253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 87/233 (37%)
Tryp_SPc 76..305 CDD:238113 88/234 (38%)
AgaP_AGAP004770XP_318046.3 Tryp_SPc 30..253 CDD:214473 87/233 (37%)
Tryp_SPc 31..256 CDD:238113 88/234 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.