DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3355 and LOC108648896

Sequence 1:NP_608848.1 Gene:CG3355 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_017953072.1 Gene:LOC108648896 ID: Length:337 Species:Xenopus tropicalis

Alignment Length:270 Identity:103/271 (38%)
Similarity:139/271 (51%) Gaps:37/271 (14%)


  Fly    68 CGTPNV-NRIVGGQQVRSNKYPWTAQL-VKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITI 130
            ||.|.| :||:|||..:..::||.... ..|||    ||||:||:|::|::||||...:| .:.:
 Frog    25 CGKPVVSSRIMGGQSAQEGQWPWQVSFRNNGRH----FCGGTLISDQWVISAAHCFPSSR-WVNV 84

  Fly   131 RLLQIDRSSRDPGIVRKVV--------------QTTVHPNYDPNRIVNDVALLKLESPVPLTGNM 181
            |:|.....||...|...:.              :|.: |:|.......|::|::..|||..|..:
 Frog    85 RVLMGRAGSRQANIHPTIAVGVLFPHSPALFCWKTNI-PSYVNEGDSGDISLVRHASPVTYTNYI 148

  Fly   182 RPVCLPEANHNF-DGKTAVVAGWGLIKEGG--VTSNYLQEVNVPVITNAQCRQTRYKD------- 236
            .|||||.....| .|....|.|||.|..|.  .:...||||.||:|...|| .|.|:.       
 Frog   149 LPVCLPADTVTFPTGLQCWVTGWGNIAYGANLPSPMTLQEVAVPLIGADQC-NTLYQTPNSYGTS 212

  Fly   237 --KIAEVMLCAGLVQQGGKDACQGDSGGPLIVN-EGRYKLAGVVSFGYGCAQKNAPGVYARVSKF 298
              .:...|:|||.. .||||:|||||||||:.: .|::.||||||||.||.|...||||..:..:
 Frog   213 SISVHSDMICAGFT-NGGKDSCQGDSGGPLVCSTNGQWFLAGVVSFGEGCGQAYRPGVYTLMPSY 276

  Fly   299 LDWIRKNTAD 308
            .|||..|..|
 Frog   277 TDWIVSNAPD 286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 96/255 (38%)
Tryp_SPc 76..305 CDD:238113 96/257 (37%)
LOC108648896XP_017953072.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.