DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and LOC101732036

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_031749232.1 Gene:LOC101732036 / 101732036 -ID:- Length:308 Species:Xenopus tropicalis


Alignment Length:266 Identity:90/266 - (33%)
Similarity:136/266 - (51%) Gaps:51/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGTPNV--NRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVH-------- 122
            ||.|.|  :||||||..:..:.||  |:|.. |.....|||:||:..:|||.||||.        
 Frog    33 CGKPVVVSSRIVGGQDTKKGQNPW--QVVVW-HSGIKNCGGTLISSSFVLTVAHCVERVNASSVI 94

  Fly   123 ---------GN-RDQITIRLLQIDRSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPL 177
                     || ::::::.             |:::::   |..|:..:...|:|||:|...||.
 Frog    95 VILGAYKITGNLKEEVSVP-------------VKRIIK---HHLYNEAKFPYDIALLELSRNVPF 143

  Fly   178 TGNMRPVCLPEANHNF-DGKTAVVAGWGLIKEGGV--TSNYLQEVNVPVITNAQCR---QTRYKD 236
            |..:.|.|||..:..| .|.:.:|.|||..:....  ..:.||||.|.:||...||   ::..||
 Frog   144 TDFILPACLPAPSVEFRPGHSCIVTGWGDTEYNSTKPRPDILQEVEVRLITLEDCRDLYKSALKD 208

  Fly   237 K---IAEVMLCAGLVQQGGKDACQGDSGGPLIVNEG-RYKLAGVVSFGYGCAQKNAPGVYARVSK 297
            |   |.:.::||..:.: |:|:||||.||||:..|. |:.|.|:||:|.||. ...|.:|:.|..
 Frog   209 KYIGITDDIICAMNIHK-GRDSCQGDGGGPLVCYENDRWYLIGLVSYGIGCG-IGIPKLYSSVPA 271

  Fly   298 FLDWIR 303
            .::|||
 Frog   272 HMEWIR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 83/254 (33%)
Tryp_SPc 76..305 CDD:238113 85/256 (33%)
LOC101732036XP_031749232.1 Tryp_SPc 43..279 CDD:238113 85/256 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.