DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HP6 and cbx1

Sequence 1:NP_608842.1 Gene:HP6 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001017150.1 Gene:cbx1 XenbaseID:XB-GENE-1005974 Length:184 Species:Xenopus tropicalis

Alignment Length:93 Identity:46/94 (49%)
Similarity:60/94 (64%) Gaps:6/94 (6%)


  Fly     3 SSTLTSSTALPVKQRN------GFDLGLEPLRILGACNWSGKLTFLMQWKGCDEAGLVPAEVLNV 61
            |.|.....:.|.|:::      ||..||||.||:||.:.||:|.|||:||..|||.||||:..||
 Frog    89 SDTEVGEESKPKKKKDEVEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANV 153

  Fly    62 RCPQMVISFYEERIVFTDEGDEEDLESD 89
            :|||:||||||||:.:.....|||.:.|
 Frog   154 KCPQVVISFYEERLTWHSYPSEEDDKKD 181

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HP6NP_608842.1 Chromo_shadow 25..76 CDD:279701 34/51 (67%)
cbx1NP_001017150.1 Chromo 27..70 CDD:278797
Chromo_shadow 117..168 CDD:279701 34/51 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1628171at2759
OrthoFinder 1 1.000 FOG0000276
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.