DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HP6 and Cbx7

Sequence 1:NP_608842.1 Gene:HP6 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster
Sequence 2:XP_006242082.1 Gene:Cbx7 RGDID:735027 Length:251 Species:Rattus norvegicus

Alignment Length:67 Identity:20/68 (29%)
Similarity:37/68 (54%) Gaps:15/68 (22%)


  Fly    37 GKLTFLMQWKGCDE--AGLVPAEVLNVRCPQMVISFYEERIVFTDEGDEEDLESDNGY-ETTPSP 98
            ||:.:|::|||...  :...|.|  ::..|::|:: |||:       :|:|..|  || :..|.|
  Rat    24 GKVEYLVKWKGWPPKYSTWEPEE--HILDPRLVMA-YEEK-------EEKDRAS--GYRKRGPKP 76

  Fly    99 RK 100
            ::
  Rat    77 KR 78

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HP6NP_608842.1 Chromo_shadow 25..76 CDD:279701 13/41 (32%)
Cbx7XP_006242082.1 CHROMO 10..62 CDD:214605 13/48 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.