DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HP6 and Cbx2

Sequence 1:NP_608842.1 Gene:HP6 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001100541.1 Gene:Cbx2 RGDID:1588561 Length:523 Species:Rattus norvegicus

Alignment Length:128 Identity:25/129 (19%)
Similarity:43/129 (33%) Gaps:65/129 (50%)


  Fly    37 GKLTFLMQWKGCDEA--GLVPAEVLNVRCPQMVISF----YEERI-------------------- 75
            |||.:|::|:|....  ...|.|  |:..|:::::|    :|:.:                    
  Rat    25 GKLEYLVKWRGWSSKHNSWEPEE--NILDPRLLLAFQKKEHEKEVQNRKRGKRPRGRPRKHTVMS 87

  Fly    76 ------------------------------VFTDEGDEEDLESD-------NGYETTPSPRKK 101
                                          ..:||.:|:|.:||       .|.||.|.|:||
  Rat    88 SCSRRSKLKEPDAPSKSKSSSSSSSSTSSSSSSDEEEEDDDDSDLDSKRGSRGRETHPVPQKK 150

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HP6NP_608842.1 Chromo_shadow 25..76 CDD:279701 12/95 (13%)
Cbx2NP_001100541.1 Chromo 15..61 CDD:278797 11/38 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.