DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HP6 and Mphosph8

Sequence 1:NP_608842.1 Gene:HP6 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001017375.2 Gene:Mphosph8 RGDID:1305133 Length:851 Species:Rattus norvegicus

Alignment Length:114 Identity:28/115 (24%)
Similarity:50/115 (43%) Gaps:22/115 (19%)


  Fly     9 STALPVKQRNGFDLGLEPLRILGACNWSGKLTFLMQWKG--CDEAGLVPAEVLNVRCPQMVISFY 71
            :.|:...:.:|.|: .|..|||......||..:.::|||  .|:....| ||....|.::::.|.
  Rat    45 TVAVGDSEEDGEDV-FEVERILDMKCEGGKNLYKVRWKGYTSDDDTWEP-EVHLEDCKEVLLEFR 107

  Fly    72 EE------RIVFTD-----------EGDEE-DLESDNGYETTPSPRKKR 102
            ::      :.|..|           |.|.: |.:.|...:|:|..:||:
  Rat   108 KKVAENKAKAVRKDIQKLSLNNDIFEADSDIDQQGDTKEDTSPRKKKKK 156

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HP6NP_608842.1 Chromo_shadow 25..76 CDD:279701 15/59 (25%)
Mphosph8NP_001017375.2 CHROMO 58..109 CDD:214605 15/53 (28%)
Histone H3K9me3 binding. {ECO:0000250|UniProtKB:Q99549} 80..87 4/7 (57%)
ANK 586..710 CDD:238125
ANK 1 591..620
ANK repeat 594..622 CDD:293786
Ank_2 597..686 CDD:289560
ANK repeat 624..655 CDD:293786
ANK 2 624..653
ANK repeat 657..686 CDD:293786
ANK 3 657..686
ANK 4 690..719
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.