DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Paris and CG14711

DIOPT Version :10

Sequence 1:NP_608840.1 Gene:Paris / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster


Alignment Length:399 Identity:108/399 - (27%)
Similarity:158/399 - (39%) Gaps:111/399 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ICRVCM--DISGK-LVNIFDARRRTRVSIAEMIAQCTGFEVKRGDLFS----------EMICPQC 55
            :||:|:  ||:.: :..:||          :..|||.....|..::.|          .|:|..|
  Fly     6 LCRICLTEDINSEAMAPLFD----------DNDAQCRELVRKIEEVGSIKLVPLQNIPSMLCYSC 60

  Fly    56 YEDVKSAYGIRQTCEESHQFYCR------------------VRD-------------EGIEDAL- 88
            .|.:.||:..|:.|:||.:.:..                  |.|             :|:||.: 
  Fly    61 VERLTSAHKFRELCQESERTFATNVVKAEMKSEPTDEVPHVVADNIEYIYESANDFIDGVEDDIG 125

  Fly    89 CALLEEEDWEISEDEDARIDSASAADDD---------GKSDSKKVAFE-CRECHKKYQR------ 137
            ...:.||..|....|.::....|...||         ..:||.....| ||:...:..|      
  Fly   126 MENIMEEPLEDGVGETSQAYETSTVVDDLDEDDLLVPNSTDSDYQPIERCRKAKVRKTRMTKRGR 190

  Fly   138 ---KGTFLRHMRT----------------HMDGQSFPCPYCKRNFRLRVTLKAHMKTHNAAKPYE 183
               :|....|.|:                .:...:..|..|...:..|..|..||:.|.|.||::
  Fly   191 GRPRGASSGHPRSFSEERPPVQASFKSSPEVSSTNIMCEICGNIYSKRAALNIHMRRHMAEKPFK 255

  Fly   184 CSHCAKTFAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFT 248
            |..|:|:||..|.|..|.|.||||:||.|..|:::|...|...||.|||.:||||.||.|.|.|:
  Fly   256 CEICSKSFAGPSELNRHIRVHTGEKPFLCKYCNRSFADRSSNIRHERTHTNERPFTCSTCGKAFS 320

  Fly   249 RKFHLDNHFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHK 313
            ....|.||..:||||:||.|..|.|.|:.|..|.||                    |.:...:..
  Fly   321 YSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQH--------------------LGTMTHQQT 365

  Fly   314 LVHNA-ERT 321
            ::|:. |||
  Fly   366 VIHHKNERT 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ParisNP_608840.1 zf-AD 4..78 CDD:462262 22/86 (26%)
C2H2 Zn finger 128..148 CDD:275368 6/44 (14%)
C2H2 Zn finger 156..176 CDD:275368 6/19 (32%)
COG5048 <180..341 CDD:227381 57/143 (40%)
C2H2 Zn finger 184..204 CDD:275368 9/19 (47%)
C2H2 Zn finger 212..232 CDD:275368 7/19 (37%)
C2H2 Zn finger 240..260 CDD:275368 8/19 (42%)
C2H2 Zn finger 268..288 CDD:275368 8/19 (42%)
C2H2 Zn finger 296..316 CDD:275368 1/19 (5%)
C2H2 Zn finger 324..341 CDD:275368
CG14711NP_650094.1 zf-AD 6..81 CDD:462262 22/84 (26%)
C2H2 Zn finger 228..248 CDD:275368 6/19 (32%)
COG5048 249..>362 CDD:227381 54/132 (41%)
C2H2 Zn finger 256..276 CDD:275368 9/19 (47%)
C2H2 Zn finger 284..304 CDD:275368 7/19 (37%)
C2H2 Zn finger 312..332 CDD:275368 8/19 (42%)
C2H2 Zn finger 340..362 CDD:275368 9/41 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.