DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15436 and pita

Sequence 1:NP_608840.1 Gene:CG15436 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster

Alignment Length:484 Identity:112/485 (23%)
Similarity:170/485 (35%) Gaps:173/485 (36%)


  Fly     4 ICRVCMDISGKLVNIFD--ARRRTRVSIAEMIAQCTGFEVKRGDLFSEMICPQCYEDVKSAYGIR 66
            :||.|: ...||.:||:  .|.:|..::...|...|..||..||.....||.:|....:..|..:
  Fly    17 VCRFCL-TEQKLASIFEENPRVKTTANLPLQIMAITAIEVYAGDGMPGHICLECRLLFEHCYRFK 80

  Fly    67 QTCE------------------------------------------------------------- 70
            |.|:                                                             
  Fly    81 QMCKRAETLLRQYPLTGNWPSPLEKPRAPMTMVASKKLLVVPAKTAEPSETPKKLLNTMAKSSSQ 145

  Fly    71 ---------------------------ESHQFYCRVRDEGIE---DALCALLEEEDWEISED--- 102
                                       .||.:..:| |...|   |.:.::||:...|:.::   
  Fly   146 VIIEDVQVLESAMVTPRTVAGSSPVPRRSHAYELKV-DNNQELSMDDVQSMLEDMASELEKEFPD 209

  Fly   103 ------------------------------------EDARIDSASAA--------------DDDG 117
                                                :..|.||.:.|              .||.
  Fly   210 IPQKASPVKPKVLNKSSIRILNKGPAAPVEPRLATPKVKRDDSGNVAIVTEVLDSDLPLDDQDDP 274

  Fly   118 KSDSKKVAFECRECHKKYQRKGTFLRHMRTHMDGQSFPCPYCKRNFRLRVTLKAHMKTHNAAKPY 182
            ..:::|||.:.                         ||||.|:|:|.|:..|:.|...|..::.:
  Fly   275 TKNAEKVATDV-------------------------FPCPDCERSFPLQQLLEIHRLNHTRSRSF 314

  Fly   183 ECSHCAKTFAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTF 247
            :|..|.|:|..:..|..|...|||||||||:.|||.|.:.:.|.||.|||.....|.|..|.|.|
  Fly   315 QCLLCEKSFFSKYDLAKHNFVHTGERPFKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPF 379

  Fly   248 TRKFHLDNHFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEH 312
            ..:..::.|...|..:|||:|..|.|:||.||.|::|..:|..:.||.|.||.::|..:|.|..|
  Fly   380 LSRQEMEKHAERHQKKRPFQCGVCTKSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARH 444

  Fly   313 KLVHNAERTFKCPHCASFYKQRKTLARHI 341
            .:.|..:|.:.|.:|...|.....|:||:
  Fly   445 LVAHAGKRAYPCKYCHKSYMLSHHLSRHL 473

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071 23/164 (14%)
C2H2 Zn finger 128..148 CDD:275368 0/20 (0%)
C2H2 Zn finger 156..176 CDD:275368 8/20 (40%)
COG5048 <180..341 CDD:227381 62/161 (39%)
C2H2 Zn finger 184..204 CDD:275368 6/20 (30%)
zf-H2C2_2 197..219 CDD:290200 14/22 (64%)
C2H2 Zn finger 212..232 CDD:275368 10/20 (50%)
zf-H2C2_2 224..249 CDD:290200 11/25 (44%)
C2H2 Zn finger 240..260 CDD:275368 5/20 (25%)
zf-H2C2_2 252..276 CDD:290200 9/24 (38%)
C2H2 Zn finger 268..288 CDD:275368 9/20 (45%)
C2H2 Zn finger 296..316 CDD:275368 7/20 (35%)
C2H2 Zn finger 324..341 CDD:275368 6/17 (35%)
pitaNP_611806.3 zf-AD 17..92 CDD:214871 21/76 (28%)
COG5048 <281..506 CDD:227381 75/219 (34%)
C2H2 Zn finger 288..308 CDD:275368 8/20 (40%)
C2H2 Zn finger 316..336 CDD:275368 6/20 (30%)
zf-H2C2_2 328..353 CDD:290200 15/25 (60%)
C2H2 Zn finger 344..364 CDD:275368 10/20 (50%)
C2H2 Zn finger 372..388 CDD:275370 4/16 (25%)
C2H2 Zn finger 400..420 CDD:275368 9/20 (45%)
C2H2 Zn finger 428..448 CDD:275368 7/20 (35%)
C2H2 Zn finger 456..476 CDD:275368 6/19 (32%)
C2H2 Zn finger 486..506 CDD:275368
HARE-HTH <566..625 CDD:294801
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C100487804
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I3342
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
33.080

Return to query results.
Submit another query.