DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3652 and YIP1

DIOPT Version :9

Sequence 1:NP_608828.2 Gene:CG3652 / 33643 FlyBaseID:FBgn0031600 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_011688.3 Gene:YIP1 / 853082 SGDID:S000003404 Length:248 Species:Saccharomyces cerevisiae


Alignment Length:214 Identity:49/214 - (22%)
Similarity:82/214 - (38%) Gaps:51/214 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ATSASGVPEYNTLDEPIRETVLRDIRAVGIKFYHVL---------------YPKEKSSLLRDWDL 80
            |.|..|.|.    :.|:.|       .:||.|.|::               .|:|   :|.|.||
Yeast    61 ALSTKGYPH----EPPLLE-------EIGINFDHIITKTKMVLIPIRFGSGVPQE---ILNDSDL 111

  Fly    81 WGPLVLCTFMATILQGSSTADSMSDNGPEFAQVFVIVWIGAAVVTLNSKLLGG-------NISFF 138
            .|||:........|        :......|..::.:...|...:...|||:..       |:.||
Yeast   112 AGPLIFFLLFGLFL--------LMAGKVHFGYIYGVALFGTISLHNLSKLMSNNDTSTQTNLQFF 168

  Fly   139 QSVCVLGYCLTPVAISLIVCRVILLATQTRLLFFLRFVTTTIGFAWATYASFVFLGQ-SQPPHRK 202
            .:..:||||..|      :|.:.||.....|.....:|.:.:...|:|:.|..||.. .|..:.:
Yeast   169 NTASILGYCFLP------LCFLSLLGIFHGLNNTTGYVVSVLFVIWSTWTSSGFLNSLLQLQNAR 227

  Fly   203 PLAVYPIFLFFFIISWLVL 221
            .|..||:.:|:.:.:.:|:
Yeast   228 LLIAYPLLIFYSVFALMVI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3652NP_608828.2 Yip1 <31..221 CDD:304430 48/212 (23%)
YIP1NP_011688.3 YIP1 3..248 CDD:227412 49/214 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5080
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.