DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3652 and YIP4

Sequence 1:NP_608828.2 Gene:CG3652 FlyBaseID:FBgn0031600 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_011317.2 Gene:YIP4 SGDID:S000003166 Length:235 Species:Saccharomyces cerevisiae

Alignment Length:230 Identity:52/231 (23%)
Similarity:94/231 (41%) Gaps:54/231 (23%)


  Fly    16 SLEGDMSIPGKRTTTATSASGVPEYNTLDEPIRETVLRDIRAVGIKFYHVLYPKEKS-------- 72
            ::.|.|...|.|             .||||.:.:|:.||:..:..:...|:||...|        
Yeast    30 NIGGTMQNSGSR-------------GTLDETVLQTLKRDVVEINSRLKQVVYPHFPSFFSPSDDG 81

  Fly    73 ------SLLRDWDLWGPLVLCTFMATILQGSSTADSMSDNGPEFAQVFVIVWIGAAVVTLNSKLL 131
                  .:..:.|||.||......:..:   |.|.|:      |:.:||..|....|:.|:.:|.
Yeast    82 IGAADNDISANCDLWAPLAFIILYSLFV---SHARSL------FSSLFVSSWFILLVMALHLRLT 137

  Fly   132 GGN--ISFFQSVCVLGYCLTPVAISLIVCRVIL-----LATQ----TRLLFFLRFVTTTIGFAWA 185
            ..:  :|....:.:.||||.|..::.:|.:::|     :..|    .|:|..::.|...:...|:
Yeast   138 KPHQRVSLISYISISGYCLFPQVLNALVSQILLPLAYHIGKQNRWIVRVLSLVKLVVMALCLMWS 202

  Fly   186 TYA-SFVFLGQSQPPHRKPLAVYPIFLFFFIISWL 219
            ..| |:|      ...:..:.:||:.|..|.::||
Yeast   203 VAAVSWV------TKSKTIIEIYPLALCLFGMAWL 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3652NP_608828.2 Yip1 <31..221 CDD:304430 48/216 (22%)
YIP4NP_011317.2 Yip1 1..231 CDD:328794 51/229 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C35476114
eggNOG 1 0.900 E1_COG5080
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I1803
Isobase 1 0.950 0 Normalized mean entropy S1968
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003974
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128256
Panther 1 1.100 LDO PTHR21236
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1889
TreeFam 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.