DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3652 and AT4G30260

Sequence 1:NP_608828.2 Gene:CG3652 FlyBaseID:FBgn0031600 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001328958.1 Gene:AT4G30260 AraportID:AT4G30260 Length:355 Species:Arabidopsis thaliana

Alignment Length:211 Identity:73/212 (34%)
Similarity:115/212 (54%) Gaps:23/212 (11%)


  Fly    18 EGDMSIPGKRTTTATSASGVPEYNTLDEPIRETVLRDIRAVGIKFYHVLYP----KEKSSLLRDW 78
            ||:.||.|       |..|.|. |||.||:.:||.||:..:......|::|    ::....||||
plant   164 EGNKSIGG-------SGFGSPP-NTLTEPVWDTVKRDLSRIVSNLKLVVFPNPYREDPGKALRDW 220

  Fly    79 DLWGPLVLCTFMATILQGSSTADSMSDNGPEFAQVFVIVWIGAAVVTLNSKLLGGNISFFQSVCV 143
            |||||.....|:...|..|::.    .....||..|.::..||.::|||..||||:|.||||:.:
plant   221 DLWGPFFFIVFLGLTLSWSASV----KKSEVFAVAFALLAAGAVILTLNVLLLGGHIIFFQSLSL 281

  Fly   144 LGYCLTPVAISLIVCRVILLATQTRLLFFLRFVTTTIGFAWATYASFVFLGQSQPPHRKPLAVYP 208
            |||||.|:.:..::|   :|....    .|:.|..::..||:::|::.|:..:..|.||.||:||
plant   282 LGYCLFPLDVGAVIC---MLKDNV----ILKMVVVSVTLAWSSWAAYPFMSAAVNPRRKALALYP 339

  Fly   209 IFLFFFIISWLVLSHN 224
            :||.:..:.:|:::.|
plant   340 VFLMYVSVGFLIIAIN 355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3652NP_608828.2 Yip1 <31..221 CDD:304430 67/194 (35%)
AT4G30260NP_001328958.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H15501
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1287193at2759
OrthoInspector 1 1.000 T124903
orthoMCL 1 0.900 OOG5_128256
Panther 1 1.100 LDO PTHR21236
Phylome 1 0.910 0.667 Consistency score
87.930

Return to query results.
Submit another query.