DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3652 and Yipf6

Sequence 1:NP_608828.2 Gene:CG3652 FlyBaseID:FBgn0031600 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_006528401.2 Gene:Yipf6 MGIID:1925179 Length:420 Species:Mus musculus

Alignment Length:215 Identity:114/216 (53%)
Similarity:156/216 (72%) Gaps:8/216 (4%)


  Fly    10 DVNTSPS--LEGDMSIPGKRTTTATSASGVPEYNTLDEPIRETVLRDIRAVGIKFYHVLYPKEKS 72
            ||:.|..  :||:::||.:.......:|      ||:|.||.|::||::|||.||.|||||::.:
Mouse   209 DVSISQDIPIEGEITIPSRARAQEHDSS------TLNESIRRTIMRDLKAVGRKFMHVLYPRKSN 267

  Fly    73 SLLRDWDLWGPLVLCTFMATILQGSSTADSMSDNGPEFAQVFVIVWIGAAVVTLNSKLLGGNISF 137
            :|||||||||||:||..:|.:||.||........|||||:||||:|.||..:|||||||||||||
Mouse   268 ALLRDWDLWGPLILCVTLALMLQKSSIDGKNDGGGPEFAEVFVIIWFGAVTITLNSKLLGGNISF 332

  Fly   138 FQSVCVLGYCLTPVAISLIVCRVILLATQTRLLFFLRFVTTTIGFAWATYASFVFLGQSQPPHRK 202
            |||:||||||:.|:.|::::||::|||.|..:.|.:|.....:.|||:..||..||..||||:||
Mouse   333 FQSLCVLGYCILPLNIAMLICRLLLLAGQGPINFMIRLFVVLLMFAWSVVASTAFLADSQPPNRK 397

  Fly   203 PLAVYPIFLFFFIISWLVLS 222
            .|||||:|||:|:|||::|:
Mouse   398 ALAVYPVFLFYFVISWMILT 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3652NP_608828.2 Yip1 <31..221 CDD:304430 106/190 (56%)
Yipf6XP_006528401.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C35475053
eggNOG 1 0.900 E1_COG5080
Hieranoid 1 1.000
Homologene 1 1.000 H15501
Inparanoid 1 1.050 244 1.000 Inparanoid score I3264
Isobase 1 0.950 0 Normalized mean entropy S1968
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003974
OrthoInspector 1 1.000 T1084783
orthoMCL 1 0.900 OOG5_128256
Panther 1 1.100 LDO PTHR21236
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1889
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.