DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3652 and yipf6

Sequence 1:NP_608828.2 Gene:CG3652 FlyBaseID:FBgn0031600 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001015932.1 Gene:yipf6 XenbaseID:XB-GENE-1009736 Length:233 Species:Xenopus tropicalis

Alignment Length:209 Identity:120/210 (57%)
Similarity:164/210 (78%) Gaps:1/210 (0%)


  Fly    16 SLEGDMSIPGKRTTTATSASGVPEYNTLDEPIRETVLRDIRAVGIKFYHVLYPKEKSSLLRDWDL 80
            |:.||:.:.|:.|....|.|...:.:|||||:::|::||::|||.||.||:|||:.::|||||||
 Frog    23 SISGDIPVEGEITVPMASTSQEDDLSTLDEPVKDTIMRDLKAVGNKFLHVMYPKKSTTLLRDWDL 87

  Fly    81 WGPLVLCTFMATILQGSSTADSMSDNGPEFAQVFVIVWIGAAVVTLNSKLLGGNISFFQSVCVLG 145
            |||||||..:|.:|||.: |||..|.||:||:||||:|.||.|:|||||||||.||||||:||||
 Frog    88 WGPLVLCVSLALMLQGGN-ADSKDDGGPQFAEVFVIIWFGAVVITLNSKLLGGTISFFQSLCVLG 151

  Fly   146 YCLTPVAISLIVCRVILLATQTRLLFFLRFVTTTIGFAWATYASFVFLGQSQPPHRKPLAVYPIF 210
            ||:.|:.::::|||::||.:.|...|.:|.|..|:.|||:|:||..||..||||:|:.|||||||
 Frog   152 YCILPLTVAMLVCRLVLLLSHTTASFIVRLVVVTVMFAWSTFASTAFLADSQPPNRRALAVYPIF 216

  Fly   211 LFFFIISWLVLSHN 224
            ||:|:|||:||:.|
 Frog   217 LFYFVISWMVLTFN 230

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3652NP_608828.2 Yip1 <31..221 CDD:304430 113/190 (59%)
yipf6NP_001015932.1 Yip1 <50..227 CDD:328794 110/178 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C35473377
eggNOG 1 0.900 E1_COG5080
Hieranoid 1 1.000
Homologene 1 1.000 H15501
Inparanoid 1 1.050 269 1.000 Inparanoid score I2833
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003974
OrthoInspector 1 1.000 T1060745
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1889
TreeFam 1 0.960
1110.790

Return to query results.
Submit another query.