DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3652 and Yipf7

DIOPT Version :9

Sequence 1:NP_608828.2 Gene:CG3652 / 33643 FlyBaseID:FBgn0031600 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001102331.1 Gene:Yipf7 / 364147 RGDID:1310766 Length:256 Species:Rattus norvegicus


Alignment Length:233 Identity:54/233 - (23%)
Similarity:93/233 - (39%) Gaps:49/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DMFEDVNTSPSLEGDMSIPGKRTTTATSASGVPEYNTLDEPIRETVLRDIRAVGIKFYH------ 64
            :||    .|....|.:..|.......:.:|.|..::  :||   .:|.::   ||.|.|      
  Rat    55 EMF----LSSDYGGQLFQPASNLHYYSQSSSVDSFD--EEP---PLLEEL---GINFDHIWQKTL 107

  Fly    65 -VLYPKEKS--SLLRDWDLWGPLVLCTFM-ATILQGSSTADSMSDNGPEFAQVFVIVWIGA-AVV 124
             ||.|.:.:  |::.:.||.||::.|..: ||:|.....         :|..::.:..||. .:.
  Rat   108 TVLNPMKPADGSIMNETDLTGPILFCVALGATLLMAGKA---------QFGYIYGMSAIGCFGIH 163

  Fly   125 TLNSKLLGGNISFFQSVCVLGYCLTPVAISLIVCRVIL-----LATQTRLLFFLRFVTTTIGFAW 184
            .|.:.:....:|:.....||||||.|:.| |..|.|..     ..|.:.||.          ..|
  Rat   164 ALLNLMSSSGVSYGCVASVLGYCLLPMVI-LSSCAVFFSLQGTAGTMSALLI----------ITW 217

  Fly   185 ATY-ASFVFLGQSQPPHRKPLAVYPIFLFFFIISWLVL 221
            .:. ||.:|:.......::.|..||..|.:.:.:.|.:
  Rat   218 CSLSASKIFISALAMEGQQLLVAYPCALLYGLFALLTV 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3652NP_608828.2 Yip1 <31..221 CDD:304430 49/206 (24%)
Yipf7NP_001102331.1 Yip1 <78..256 CDD:419731 49/206 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5080
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.