DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3652 and Yipf7

Sequence 1:NP_608828.2 Gene:CG3652 FlyBaseID:FBgn0031600 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_006251101.1 Gene:Yipf7 RGDID:1310766 Length:289 Species:Rattus norvegicus

Alignment Length:233 Identity:54/234 (23%)
Similarity:93/234 (40%) Gaps:49/234 (21%)


  Fly     6 DMFEDVNTSPSLEGDMSIPGKRTTTATSASGVPEYNTLDEPIRETVLRDIRAVGIKFYH------ 64
            :||    .|....|.:..|.......:.:|.|..::  :||   .:|.::   ||.|.|      
  Rat    88 EMF----LSSDYGGQLFQPASNLHYYSQSSSVDSFD--EEP---PLLEEL---GINFDHIWQKTL 140

  Fly    65 -VLYPKEKS--SLLRDWDLWGPLVLCTFM-ATILQGSSTADSMSDNGPEFAQVFVIVWIGA-AVV 124
             ||.|.:.:  |::.:.||.||::.|..: ||:|.....         :|..::.:..||. .:.
  Rat   141 TVLNPMKPADGSIMNETDLTGPILFCVALGATLLMAGKA---------QFGYIYGMSAIGCFGIH 196

  Fly   125 TLNSKLLGGNISFFQSVCVLGYCLTPVAISLIVCRVIL-----LATQTRLLFFLRFVTTTIGFAW 184
            .|.:.:....:|:.....||||||.|:.| |..|.|..     ..|.:.||.          ..|
  Rat   197 ALLNLMSSSGVSYGCVASVLGYCLLPMVI-LSSCAVFFSLQGTAGTMSALLI----------ITW 250

  Fly   185 ATY-ASFVFLGQSQPPHRKPLAVYPIFLFFFIISWLVL 221
            .:. ||.:|:.......::.|..||..|.:.:.:.|.:
  Rat   251 CSLSASKIFISALAMEGQQLLVAYPCALLYGLFALLTV 288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3652NP_608828.2 Yip1 <31..221 CDD:304430 49/207 (24%)
Yipf7XP_006251101.1 Yip1 <111..289 CDD:304430 49/207 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5080
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.