DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3652 and Yipf6

Sequence 1:NP_608828.2 Gene:CG3652 FlyBaseID:FBgn0031600 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001020918.1 Gene:Yipf6 RGDID:1566154 Length:236 Species:Rattus norvegicus

Alignment Length:216 Identity:113/217 (52%)
Similarity:155/217 (71%) Gaps:10/217 (5%)


  Fly    10 DVNTSPS--LEGDMSIP-GKRTTTATSASGVPEYNTLDEPIRETVLRDIRAVGIKFYHVLYPKEK 71
            ||:.|..  :||:::|| |.|.....|       :||:|.||.|::||::|||.||.|||||::.
  Rat    25 DVSISQDIPIEGEITIPSGTRAQECDS-------STLNESIRRTIMRDLKAVGRKFMHVLYPRKS 82

  Fly    72 SSLLRDWDLWGPLVLCTFMATILQGSSTADSMSDNGPEFAQVFVIVWIGAAVVTLNSKLLGGNIS 136
            ::|||||||||||:||..:|.:||.||.........||||:||||:|.||..:||||||||||||
  Rat    83 NTLLRDWDLWGPLILCVSLALMLQKSSVEGKRDGGSPEFAEVFVIIWFGAVTITLNSKLLGGNIS 147

  Fly   137 FFQSVCVLGYCLTPVAISLIVCRVILLATQTRLLFFLRFVTTTIGFAWATYASFVFLGQSQPPHR 201
            ||||:||||||:.|:.|::::||::|||.|..:.|.:|.....:.|||:..||..||...|||:|
  Rat   148 FFQSLCVLGYCVLPLNIAMLICRLLLLAGQGPINFMIRLFVVLVMFAWSVIASTAFLADCQPPNR 212

  Fly   202 KPLAVYPIFLFFFIISWLVLS 222
            |.|||||:|||:|::||::|:
  Rat   213 KALAVYPVFLFYFVVSWMILT 233

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3652NP_608828.2 Yip1 <31..221 CDD:304430 103/190 (54%)
Yipf6NP_001020918.1 Yip1 2..232 CDD:304430 112/214 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C35471422
eggNOG 1 0.900 E1_COG5080
Hieranoid 1 1.000
Homologene 1 1.000 H15501
Inparanoid 1 1.050 240 1.000 Inparanoid score I3216
OMA 1 1.010
OrthoDB 1 1.010 D1287193at2759
OrthoFinder 1 1.000 FOG0003974
OrthoInspector 1 1.000 T1088333
orthoMCL 1 0.900 OOG5_128256
Panther 1 1.100 LDO PTHR21236
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.