DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Traf4 and Traf3

Sequence 1:NP_477416.1 Gene:Traf4 FlyBaseID:FBgn0026319 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001102194.1 Gene:Traf3 RGDID:1304633 Length:567 Species:Rattus norvegicus

Alignment Length:523 Identity:136/524 (26%)
Similarity:206/524 (39%) Gaps:162/524 (31%)


  Fly   117 DELRKLKGHLNACKHDATQCPN----------------KCGAQIPRIMMTDHLQYTCTMRRTRC- 164
            |:.:..|..|..|....|:|.:                ||.|....|:.....:..|..|.... 
  Rat    48 DKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILAL 112

  Fly   165 -EFCQSEFSGAGLEEH----------NGSCGQEPVYC-EAKCGQRILRGRMTLHKSKDCAKRLRR 217
             .:|::|  |.|..|.          ...|..|.:.| .|.|.:::||..:..|..|.|..|...
  Rat   113 QIYCRNE--GRGCVEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRRDLRDHVEKACKYREAT 175

  Fly   218 CAHCQREFSADTLPLHA-AQCPRAPLACPQRCDAGPIPRGELEAHLRDECQSLAVSCSFKEAGCR 281
            ||||:.:....||..|. ..||...::||.:|....:.|.||.||| .||.:...:||||..||.
  Rat   176 CAHCKSQVPMITLQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHL-SECVNAPSTCSFKRYGCV 239

  Fly   282 FKGPRQMLEAHLESNAAAHLSLM----------VAL----SSRQGQQIQML-------------- 318
            |:|..|.::||..|:|..|::|:          |:|    |..:.:.||.|              
  Rat   240 FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQ 304

  Fly   319 ---------------------------------------------KSAVSKL------------- 325
                                                         ||:|..|             
  Rat   305 KEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKS 369

  Fly   326 ----------------------------------------SINYTGTLLWKITDWSAKMAEARGK 350
                                                    :.:|.|.|:|||.|:..:..||...
  Rat   370 AGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMG 434

  Fly   351 DGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFE 415
            ..|.|.|.||||..:|||:.|.::|||:|.|:.||:|::..::.|||||||.|||...:|..|.:
  Rat   435 KTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD 499

  Fly   416 QGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRPFIKGDTVFLRVKVDP 480
            ||  |.:..:.::|.|||...:|::|:.|.: :..|.|.|::..:|.:..:||.||:|::|.||.
  Rat   500 QG--SSRRHLGDAFKPDPNSSSFKKPTGEMN-IASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 561

  Fly   481 SKI 483
            |.:
  Rat   562 SDL 564

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Traf4NP_477416.1 zf-TRAF 125..179 CDD:280357 15/72 (21%)
zf-TRAF 233..292 CDD:280357 24/60 (40%)
MATH_TRAF4 331..479 CDD:239750 60/148 (41%)
Traf3NP_001102194.1 zf-C3HC4 55..90 CDD:278524 7/35 (20%)
zf-TRAF 135..191 CDD:280357 17/56 (30%)
zf-TRAF 196..246 CDD:280357 22/51 (43%)
BBP1_C <262..>320 CDD:291921 6/58 (10%)
Spc29 <306..>365 CDD:293687 4/59 (7%)
MATH_TRAF3 377..562 CDD:239746 62/188 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391991at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.