DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15429 and CB5-A

DIOPT Version :10

Sequence 1:NP_608823.2 Gene:CG15429 / 33637 FlyBaseID:FBgn0031596 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_173958.1 Gene:CB5-A / 839176 AraportID:AT1G26340 Length:135 Species:Arabidopsis thaliana


Alignment Length:65 Identity:24/65 - (36%)
Similarity:36/65 - (55%) Gaps:4/65 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RYYLKDEVVSHNKKDDCWVIIHRNIYDLTPMLKDRFDNWNRTLDYLVAHAGKDLTHFFHENGEPR 73
            :.|..:|..:|||:|||||:|...:||::..:    |......|.|:|.||||.|..|.:.|..:
plant     6 KLYSMEEAATHNKQDDCWVVIDGKVYDVSSYM----DEHPGGDDVLLAVAGKDATDDFEDAGHSK 66

  Fly    74  73
            plant    67  66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15429NP_608823.2 Cyt-b5 13..>63 CDD:459698 20/49 (41%)
CB5-ANP_173958.1 Cyt-b5 9..81 CDD:459698 23/62 (37%)

Return to query results.
Submit another query.