DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15429 and CYB5R4

DIOPT Version :10

Sequence 1:NP_608823.2 Gene:CG15429 / 33637 FlyBaseID:FBgn0031596 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_057314.2 Gene:CYB5R4 / 51167 HGNCID:20147 Length:521 Species:Homo sapiens


Alignment Length:56 Identity:19/56 - (33%)
Similarity:31/56 - (55%) Gaps:4/56 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KDEVVSHNKKDDCWVIIHRNIYDLTPMLKDRFDNWNRTLDYLVAHAGKDLTHFFHE 68
            ::|:..||||||||:.|...:|:::|.::.....    .|.|:..||.|.|..|.:
Human    59 EEELKKHNKKDDCWICIRGFVYNVSPYMEYHPGG----EDELMRAAGSDGTELFDQ 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15429NP_608823.2 Cyt-b5 13..>63 CDD:459698 17/49 (35%)
CYB5R4NP_057314.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Cyt-b5 58..130 CDD:459698 19/56 (34%)
p23_NCB5OR 170..256 CDD:107240
cyt_b5_reduct_like 278..519 CDD:99780
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.