DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15429 and Cyt-b5

DIOPT Version :10

Sequence 1:NP_608823.2 Gene:CG15429 / 33637 FlyBaseID:FBgn0031596 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster


Alignment Length:60 Identity:22/60 - (36%)
Similarity:31/60 - (51%) Gaps:4/60 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 YLKDEVVSHNKKDDCWVIIHRNIYDLTPMLKDRFDNWNRTLDYLVAHAGKDLTHFFHENG 70
            :.:.||..||...|.|::||.||||:|..|.:....    .:.|:..||||.|..|.:.|
  Fly     9 FTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGG----EEVLIEQAGKDATENFEDVG 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15429NP_608823.2 Cyt-b5 13..>63 CDD:459698 19/49 (39%)
Cyt-b5NP_610294.1 Cyt-b5 10..82 CDD:459698 22/59 (37%)

Return to query results.
Submit another query.