DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atet and AUS1

Sequence 1:NP_001097079.1 Gene:Atet FlyBaseID:FBgn0020762 Length:832 Species:Drosophila melanogaster
Sequence 2:NP_014654.1 Gene:AUS1 SGDID:S000005537 Length:1394 Species:Saccharomyces cerevisiae

Alignment Length:833 Identity:191/834 (23%)
Similarity:324/834 (39%) Gaps:233/834 (28%)


  Fly    77 VPLLSQLKLTNDLKQNSHGSQNNLCNGGLGSNNHALAPK---VANNSGG--------SPNGQKKG 130
            :|.|::       |:.:..|..|       .:.:...||   |:::|..        ||:.::  
Yeast   681 LPFLNK-------KRGTRSSARN-------DSKYVGIPKSHSVSSSSSSLSAVPYQISPSNKE-- 729

  Fly   131 TIALSHLPQRPPVD--------IEFCDISYSVTDSHRRGFKTILKSVSGKFRNGEITAIMGPSGA 187
             :||:...::|..:        |.:.:|:|:|      |.|.::.:.||...:| :||:||.|||
Yeast   730 -MALNDYNEQPITETVETQKHIISWKNINYTV------GTKKLINNASGFISSG-LTALMGESGA 786

  Fly   188 GKSTLMNILA-GYKTAQLSGSVLINSKE-RNLRRFRKLSCYIMQDDVLIANLTVREAMMVAANLK 250
            ||:||:|:|: ..:|..:||.:||:... .:...|::...::.|.|:.:..|:|:|::.::..|:
Yeast   787 GKTTLLNVLSQRVETGVVSGEILIDGHPLTDEDAFKRSIGFVQQQDLHLDLLSVKESLEISCLLR 851

  Fly   251 LGKNMISYAKVVVVEEILETIG--LKESVNTLTCNLSGGQRKRLSIALELVNNPP-VMFFDEPTS 312
             |....:|         |:|:.  ||...:.|..:|:..|||.|||.:|||..|. ::|.|||||
Yeast   852 -GDGDRAY---------LDTVSNLLKLPSDILVADLNPTQRKLLSIGVELVTKPSLLLFLDEPTS 906

  Fly   313 GLDSSTCFQLISLLRSLARGGRTIVCTIHQPSARLFEKFDHLYLLAQ-GQCVYEGRVKGLVPYLS 376
            |||:.....::..|:.|:..|:.|.|||||||..:...||:::||.: |:||:.|.:.....|..
Yeast   907 GLDAEAALTIVKFLKQLSLQGQAIFCTIHQPSKSVISHFDNIFLLKRGGECVFFGPMDDACGYFM 971

  Fly   377 S----LGYECPSYHNPADYVLEVASGEYGDAVPKLVDAVKSGACKKYAHKDYVLTLAQKGCNNDI 437
            |    |.|: ..:.||||:|               :|||                    |.:|  
Yeast   972 SHDNTLVYD-KEHDNPADFV---------------IDAV--------------------GNSN-- 998

  Fly   438 IKGSGSGAENAMAILTLEDEKPPLEDRQLEPSIPVDDPAELKPPKLETQQSQNSDCSVVNMPTNA 502
               |.:|.:.|...|||..|       .::.|...:...|.|..|.||.:.:             
Yeast   999 ---SSAGKDTAEEALTLNKE-------AIDWSALWESSVEKKLVKKETARLE------------- 1040

  Fly   503 VDDSCSFSSSKGTQNAVGGSGSGGPSAVVGCMTSLLDSHESVVTLPNKTGFPTSGW------TQF 561
             ||:               ..||                         ..:.||.|      .|.
Yeast  1041 -DDA---------------RASG-------------------------VDYTTSLWKQPSYLQQL 1064

  Fly   562 WILLKRSFRTILRDKMLTHMRLFSHVIVGAIIGMIYYDVGNEASKIMSNAGCIFFVSLFTTFTAM 626
            .::.:|.:....||......:...:...|..||..::.:.:   .|:.....|||  .|......
Yeast  1065 ALITRRQYICTKRDMTYVMAKYCLNGGAGLFIGFSFWHIKH---NIIGLQDSIFF--CFMALCVS 1124

  Fly   627 MPTI-----LTFPTEMSVFVREHLNYWYSLKAFYFAKTIADMPFQIVFSSVYVLVVYYLTSQPME 686
            .|.|     ....|:.....||..:..|.......:::|.::|..:..|:::.:..::.......
Yeast  1125 SPLINQIQDKALKTKEVYVAREARSNTYHWTVLLLSQSIIELPLALTSSTLFFVCAFFSCGFNNA 1189

  Fly   687 LERVSMFVLICVLNSLVAQSLGL-LIGAGMNIET-GVFLGPVTTI---------PTILFSGFFVN 740
            .....:|.|..:|.:....:||| ||....|::| .||:..:.:.         |..||..|:..
Yeast  1190 GWSAGVFFLNYMLFAAYYSTLGLWLIYTAPNLQTAAVFVAFIYSFTASFCGVMQPYSLFPTFWKF 1254

  Fly   741 FDTIPGYLQWV-TYVSYVRYGFE-----GAMVAIYGMDRAKMQCNQM------------------ 781
            ...:..|..:| |:||.:.:.:|     ..||.  |.......|.|.                  
Yeast  1255 MYRVSPYTYFVETFVSILLHNWEIKCDMSEMVP--GQPLTGQSCGQFMEAFIEEYGGYLHNKNTF 1317

  Fly   782 ----YCHYRVPKKFL--EEMSMDN-----ALFWVDAVALIGIFFALRIIAYFV 823
                ||.|.|...||  |.||.|:     .:.|    |.:|..|......|::
Yeast  1318 TVCAYCTYTVGDDFLKNENMSYDHVWRNFGIEW----AFVGFNFFAMFAGYYL 1366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AtetNP_001097079.1 3a01204 137..825 CDD:273361 178/763 (23%)
ABCG_EPDR 142..366 CDD:213180 79/238 (33%)
ABC2_membrane 564..767 CDD:279410 44/225 (20%)
AUS1NP_014654.1 ABCG_PDR_domain1 49..255 CDD:213200
3a01205 56..1369 CDD:273362 191/834 (23%)
ABC2_membrane 374..577 CDD:279410
PDR_CDR 590..670 CDD:283960
ABCG_PDR_domain2 748..961 CDD:213199 79/230 (34%)
ABC2_membrane 1067..1271 CDD:279410 41/209 (20%)
PDR_CDR <1328..>1362 CDD:283960 10/38 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C119985385
eggNOG 1 0.900 E1_COG1131
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000096
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.