DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atet and ABCG14

Sequence 1:NP_001097079.1 Gene:Atet FlyBaseID:FBgn0020762 Length:832 Species:Drosophila melanogaster
Sequence 2:NP_564383.1 Gene:ABCG14 AraportID:AT1G31770 Length:648 Species:Arabidopsis thaliana

Alignment Length:755 Identity:201/756 (27%)
Similarity:351/756 (46%) Gaps:147/756 (19%)


  Fly   110 HALAPKVANNSG----GSP---NGQKKGTIALSHLPQRP-------PVDIEFCDISYSV------ 154
            :.:||:...:.|    |.|   :.|.|..:|...:..:|       |:.::|.::.|.|      
plant     4 NCIAPRPEEDGGVMVQGLPDMSDTQSKSVLAFPTITSQPGLQMSMYPITLKFEEVVYKVKIEQTS 68

  Fly   155 --TDSHRRGFKTILKSVSGKFRNGEITAIMGPSGAGKSTLMNILAGYKTAQLSGSVLINSKERNL 217
              ..|.:...||||..::|....||..|::||||:||:||::.|.|..:...||.|:.|.:..: 
plant    69 QCMGSWKSKEKTILNGITGMVCPGEFLAMLGPSGSGKTTLLSALGGRLSKTFSGKVMYNGQPFS- 132

  Fly   218 RRFRKLSCYIMQDDVLIANLTVREAMMVAANLKLGKNMISYAKVVVVEEILETIGLKESVNT--- 279
            ...::.:.::.|||||..:|||.|.:...|.|:|..::....|...|:.::..:||....|:   
plant   133 GCIKRRTGFVAQDDVLYPHLTVWETLFFTALLRLPSSLTRDEKAEHVDRVIAELGLNRCTNSMIG 197

  Fly   280 --LTCNLSGGQRKRLSIALELVNNPPVMFFDEPTSGLDSSTCFQLISLLRSLARGGRTIVCTIHQ 342
              |...:|||::||:||..|::.||.::..|||||||||:|..::::.::.||.||||:|.||||
plant   198 GPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAHRIVTTIKRLASGGRTVVTTIHQ 262

  Fly   343 PSARLFEKFDHLYLLAQGQCVYEGRVKGLVPYLSSLGYECPSYHNPADYVLEVASGEYGDAVPKL 407
            ||:|::..||.:.||::|..:|.|.....|.|.||||:......||||.:|::|:|     :|. 
plant   263 PSSRIYHMFDKVVLLSEGSPIYYGAASSAVEYFSSLGFSTSLTVNPADLLLDLANG-----IPP- 321

  Fly   408 VDAVKSGACKKYAHKDYVLTLAQKGCNNDIIKGSGSGAENAMAILTLEDEKPPLEDRQL---EPS 469
             |..|.                                       |.|.|:..:::..:   |.:
plant   322 -DTQKE---------------------------------------TSEQEQKTVKETLVSAYEKN 346

  Fly   470 IPVDDPAELKPPKLETQQSQNSDCSVVNMPTNAVDDSCSFSSSKGTQNAVGGSGSGGPSAVVGCM 534
            |.....|||              |:.         :|.|:..:|..                   
plant   347 ISTKLKAEL--------------CNA---------ESHSYEYTKAA------------------- 369

  Fly   535 TSLLDSHESVVTLPNKTGFPTSGWTQFWILLKRSFRTILRDKMLTHMRLFSHVIVGAIIGMIYYD 599
            ...|.|.:          :.|:.|.||.:||:|..|. .|.:....:|:|..:.|..:.|::::.
plant   370 AKNLKSEQ----------WCTTWWYQFTVLLQRGVRE-RRFESFNKLRIFQVISVAFLGGLLWWH 423

  Fly   600 VGNEASKIMSNAGCIFFVSLFTTFTAMMPTILTFPTEMSVFVREHLNYWYSLKAFYFAKTIADMP 664
              ...|.|......:||.|:|..|..:...:.|||.|..:.::|..:..|.|.:::.|:.:.|:|
plant   424 --TPKSHIQDRTALLFFFSVFWGFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLP 486

  Fly   665 FQIVFSSVYVLVVYYLTSQPMELERVSMFVLICVLNSLVAQSLGLLIGA-GMNIETGVFLGPVTT 728
            .::...:.:|.::|::.....:.....:.:|:.:.:.||||.|||..|| .|||:....|..|||
plant   487 LELALPTAFVFIIYWMGGLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTT 551

  Fly   729 IPTILFSGFFVNFDTIPGYLQWVTYVSYVRYGFEGAMVAIYGMDRAKMQCNQ-MYCHYRV---PK 789
            :..::..|::|  ..||.::.|:.|:||..|.:: .::.|...|....:|:: ::|  ||   |.
plant   552 LVFLIAGGYYV--QQIPPFIVWLKYLSYSYYCYK-LLLGIQYTDDDYYECSKGVWC--RVGDFPA 611

  Fly   790 KFLEEMSMDNALFWVDAVALIGIFFALRIIAYFVL-RWKL 828
              ::.|.::|  .|:|...:..:....|::||..| |.||
plant   612 --IKSMGLNN--LWIDVFVMGVMLVGYRLMAYMALHRVKL 647

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AtetNP_001097079.1 3a01204 137..825 CDD:273361 190/717 (26%)
ABCG_EPDR 142..366 CDD:213180 85/237 (36%)
ABC2_membrane 564..767 CDD:279410 54/204 (26%)
ABCG14NP_564383.1 PLN03211 10..646 CDD:215634 197/747 (26%)
ABCG_EPDR 50..286 CDD:213180 85/237 (36%)
ABC2_membrane 389..588 CDD:279410 54/205 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H75179
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19241
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.