DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atet and ABCG8

Sequence 1:NP_001097079.1 Gene:Atet FlyBaseID:FBgn0020762 Length:832 Species:Drosophila melanogaster
Sequence 2:NP_200098.1 Gene:ABCG8 AraportID:AT5G52860 Length:589 Species:Arabidopsis thaliana

Alignment Length:721 Identity:179/722 (25%)
Similarity:291/722 (40%) Gaps:176/722 (24%)


  Fly   137 LPQRPPVD-----IEFCDISYSVTDSHRRGFKT---------------ILKSVSGKFRNGEITAI 181
            :|..||.:     :....|||::.       ||               ||::::......||.|:
plant     3 IPPSPPPETAAYTLTTSSISYTIP-------KTSLSLLRFPATEPPSFILRNITLTAHPTEILAV 60

  Fly   182 MGPSGAGKSTLMNILAGYKTAQLSGSVLINSKERNLRRFRKLSCYIMQDDVLIANLTVREAMMVA 246
            :||||||||||::|||. ||:..|||:|:||...|...:||:|.|:.|.|.....|||.|....|
plant    61 VGPSGAGKSTLLDILAS-KTSPTSGSILLNSIPINPSSYRKISSYVPQHDSFFPLLTVSETFSFA 124

  Fly   247 ANLKL-GKNMISYAKVVVVEEILETIGLKESVNT-LTCNLSGGQRKRLSIALELVNNPPVMFFDE 309
            |.|.| ..:::|    ..|..:|..:.|....:| |...||||:|:|:||.|.|:::|..:..||
plant   125 ACLLLPNPSIVS----ETVTSLLSELNLTHLSHTRLAQGLSGGERRRVSIGLSLLHDPCFLLLDE 185

  Fly   310 PTSGLDSSTCFQLISLLRSLA-RGGRTIVCTIHQPSARLFEKFDHLYLLAQGQCVYEGRVKGLVP 373
            |||||||.:.|.:|.:|:|:| ...||::.:|||||.::....|.|.||::|..||.||:..|..
plant   186 PTSGLDSKSAFDVIHILKSIAVSRQRTVILSIHQPSFKILSIIDRLLLLSKGTVVYHGRLDSLEG 250

  Fly   374 YLSSLGYECPSYHNPADYVLEVASGEYGDAVPKLVDAVKSGACKKYAHKDYVLTLAQKGCNNDII 438
            :|...|:..|...|..:|.:|:                             :..|.:...|.|  
plant   251 FLLFKGFTVPPQLNSLEYAMEI-----------------------------LQELRESDGNTD-- 284

  Fly   439 KGSGSGAENAMAILTLEDEKPPLEDRQLEPSIPVDDPAELKPPKLETQQSQNSDCSVVNMPTNAV 503
                     |.|:.::|:.|                              |....|:|.      
plant   285 ---------ATALPSIENRK------------------------------QREKQSIVR------ 304

  Fly   504 DDSCSFSSSKGTQNAVGGSGSGGPSAVVGCMTSLLDSHESVVTLPNKTGFPTSGWTQFWILLKRS 568
                                                             :..|..|:..:|.:|.
plant   305 -------------------------------------------------YRKSRITEISLLARRF 320

  Fly   569 FRTILRDKMLTHMRLFSHVIVGAIIGMIYYDVGNEASKIMSNAGCIFFVSLFTTFTAMMPTILTF 633
            ::.|.|.:.|........::||.::|.||.::|...:.|....|...|...| ..::...|:..|
plant   321 WKIIYRTRQLLLTNALEALVVGLVLGTIYINIGIGKAGIEKRFGMFAFTLTF-LLSSTTETLPIF 384

  Fly   634 PTEMSVFVREHLNYWYSLKAFYFAKTIADMPFQIVFSSVYVLVVYYLTSQPMELERVSMFVLICV 698
            ..|..:.:||..:..|.|.:...|.|:..:|:..|.|.:|.:.||:|.......:....|||:..
plant   385 INERPILLRETSSGIYRLSSHILANTLVFLPYLFVISIIYSVSVYFLIGLCPTWQAFGYFVLVIW 449

  Fly   699 LNSLVAQSLGLLIGA-GMNIETGVFLGPVTTIPTILFSGFFVNFDTIPGYLQWVTYVSYVRYGFE 762
            :..|:|.|..|.:.: ..|..||..|..:......||||:|::.:::|.|..::.:.|..:|..:
plant   450 IILLMANSFVLFLSSLAPNYITGTSLVTILLAAFFLFSGYFISKESLPKYWLFMYFFSMYKYALD 514

  Fly   763 GAMVAIYGMDRAKM-----QCNQMYCHYR----VPKKFLEEMSMDNALFWVDAVALIGIFFALRI 818
            ..::..|....:|.     :.....|...    :.||.|.|...     |.:...|:|.|...|:
plant   515 ALLINEYSCLASKCLVWLEEAQTKICMVTGGDVLKKKGLHEKQR-----WFNVYVLLGFFVLYRV 574

  Fly   819 IAYFVL 824
            :.:..|
plant   575 LCFLAL 580

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AtetNP_001097079.1 3a01204 137..825 CDD:273361 179/722 (25%)
ABCG_EPDR 142..366 CDD:213180 92/247 (37%)
ABC2_membrane 564..767 CDD:279410 51/204 (25%)
ABCG8NP_200098.1 P-loop_NTPase 29..243 CDD:304359 86/219 (39%)
3a01204 44..584 CDD:273361 171/674 (25%)
ABC2_membrane 316..519 CDD:279410 51/204 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19241
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.