DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atet and abcg2c

Sequence 1:NP_001097079.1 Gene:Atet FlyBaseID:FBgn0020762 Length:832 Species:Drosophila melanogaster
Sequence 2:XP_005156580.1 Gene:abcg2c ZFINID:ZDB-GENE-050517-37 Length:640 Species:Danio rerio

Alignment Length:749 Identity:202/750 (27%)
Similarity:346/750 (46%) Gaps:171/750 (23%)


  Fly   127 QKKGTIALSHLP--QRPPVDIEFCDISYSVTDSHRRGF-------KTILKSVSGKFRNGEITAIM 182
            ::..|.|...:|  |.|...:.|..|.|.:.:  |.|.       |.|||.||| ..|..:.|||
Zfish    15 EQSSTDADESVPCFQTPGPTVTFHQIRYRIKE--RLGMFSCQWREKDILKDVSG-IMNPGMNAIM 76

  Fly   183 GPSGAGKSTLMNILAGYKTAQ--LSGSVLINSK--ERNLRRFRKLSCYIMQDDVLIANLTVREAM 243
            ||:|:||::|::::||.|..:  .||.||:::.  ..:|   |..|.|::|:|:|:..|||||.:
Zfish    77 GPTGSGKTSLLDVIAGRKDPKGLKSGQVLVDNTIVTSDL---RLCSAYVVQNDILMGTLTVRENL 138

  Fly   244 MVAANLKLG-KNMISYAKVVVVEEILETIGLKESVNT-----LTCNLSGGQRKRLSIALELVNNP 302
            ..:|||:|. |...|..|.:.|..:::.:|||:..:|     ....:|||::||.||.:||:.:|
Zfish   139 AFSANLRLSLKEYSSSDKEMRVNSVIQELGLKDCADTKIGTMFLRGVSGGEKKRCSIGMELITSP 203

  Fly   303 PVMFFDEPTSGLDSSTCFQLISLLRSLARGGRTIVCTIHQPSARLFEKFDHLYLLAQGQCVYEGR 367
            .::|.||||:|||::|...::.||:::::.|:|::.:||||...:|.:||||.|:.:|:.:|.|.
Zfish   204 SLLFLDEPTTGLDANTANSIMELLQNISKKGKTVIFSIHQPRYSIFRQFDHLTLMNKGEIIYAGA 268

  Fly   368 VKGLVPYLSSLGYECPSYHNPADYVLEVASGEYGDAVPKLVDAVKSGACKKYAHKDYVLTLAQKG 432
            ....:.|...|||:|..::||||:.|:|.:|                            |:....
Zfish   269 ADKAIIYFEDLGYKCEPFNNPADFFLDVTNG----------------------------TIRPHK 305

  Fly   433 CNNDIIKGSGSGA-----ENAMAILTLEDEKPP----LEDRQLEPSIPVDDPAELKPPKLETQQS 488
            .:|:|.:...|..     ||.:|::.   .|.|    |:||                        
Zfish   306 SSNNISEKCSSSEEMVDNENPLAVMY---RKSPYFTKLKDR------------------------ 343

  Fly   489 QNSDCSVVNMPTNAVDDSCSFSSSKGTQNAVGGSGSGGPSAVVGCMTSLLDSHESVVTLPNKTGF 553
                                                         :|.:.|..:..||..:|.|:
Zfish   344 ---------------------------------------------LTEISDGLDPEVTKGDKIGY 363

  Fly   554 PTSGWTQFWILLKRSFRTILRDKMLTHMRLFSHVIVGAIIGMIYYDVGNEASKIMSN-AGCIFFV 617
            .|..:.|..::..|:.|.|||:...::.:||.::..|.::|:|||.:.:...:.:.| .|..||:
Zfish   364 ATPFYYQLLLVSGRTIRNILRNPQTSYAQLFLNIFFGILVGLIYYQIPHTLPEALQNRTGAFFFL 428

  Fly   618 SLFTTFTAMMPTILTFPTEMSVFVREHLNYWYSLKAFYFAKTIADM-PFQIVFSSVYVLVVYYLT 681
            .:...| ..:..:..|.:|..:|:.|:.:.:|...|::.:|..||: |.:|:...::..:.|::.
Zfish   429 VINMVF-GNLSAVELFVSERELFIHENSSGFYRTSAYFLSKVFADLIPNRILPVFIFSAIPYFMM 492

  Fly   682 SQPMELERVSMFVLICVLNSLV---AQSLGLLIGAGMNIETGVFLGPVTTIPTI---LFSGFFVN 740
            ....|:|   .|.|.||..|:|   |.||..|:.|  ::.:......:..:|.:   :|.||.||
Zfish   493 GLKPEVE---AFFLYCVTMSMVSLSAVSLAFLVSA--SVGSFAMANILIALPYVFMMVFGGFLVN 552

  Fly   741 FDTIPGYLQWVTYVSYVRYGFEGAMVAIYGM------DRAKMQCNQMYCHYRVPKKFLEEMSMDN 799
            .:::...|.|:.:.|..|||:..  :||..:      |........||         |:...:|.
Zfish   553 LNSMLSGLSWLKWASIFRYGYNA--LAINELKDQVFTDNLTRVTGDMY---------LDHQEIDR 606

  Fly   800 AL--FWVDAVALIGIFFALRIIAYFVL----RWK 827
            :.  ||.:.|||.||.|...|:||..|    |||
Zfish   607 SAWGFWENQVALAGIMFVCLILAYVQLCRINRWK 640

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AtetNP_001097079.1 3a01204 137..825 CDD:273361 197/736 (27%)
ABCG_EPDR 142..366 CDD:213180 88/241 (37%)
ABC2_membrane 564..767 CDD:279410 54/211 (26%)
abcg2cXP_005156580.1 ABCG_EPDR 34..267 CDD:213180 88/239 (37%)
3a01204 37..638 CDD:273361 194/724 (27%)
ABC2_membrane 377..579 CDD:279410 56/210 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1131
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000096
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.