DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atet and CG1494

Sequence 1:NP_001097079.1 Gene:Atet FlyBaseID:FBgn0020762 Length:832 Species:Drosophila melanogaster
Sequence 2:NP_001259763.1 Gene:CG1494 FlyBaseID:FBgn0031169 Length:1695 Species:Drosophila melanogaster

Alignment Length:846 Identity:169/847 (20%)
Similarity:280/847 (33%) Gaps:301/847 (36%)


  Fly   152 YSVTDSHRRGFKTILKSVSGKFR---------------NGEITAIMGPSGAGKSTLMNILAGYKT 201
            |.|..|||| ||..:|.:..:|.               ..|:|.:||.:|.|||||:.||||. .
  Fly   530 YEVEPSHRR-FKLKIKKLCKRFATNDRPALNLFSWNVYENEVTVLMGHNGCGKSTLLKILAGL-V 592

  Fly   202 AQLSGSVLINSKERNLRRFRKLSC----YIMQDDVLIANLTVREAMMVAANLK-LGKNMISYAKV 261
            ....|:|:|:|  .|::..||.:.    .....|:|:...||.:.:.....:| |..|:....:.
  Fly   593 EPSRGTVMISS--HNIQTERKAASMELGIAFGHDMLLTGFTVIDYLRFICRVKGLHNNIEIDGQS 655

  Fly   262 VVVEEILETIGLK-ESVNTLT----CNLSGGQRKRLSIALELVNNPPVMFFDEPTSGLDSSTCFQ 321
            .....:|:..||| :.:.|||    |        .:||....|.|.|::..|:..|.||..|...
  Fly   656 NYFLNVLQIGGLKTKRIRTLTDRDLC--------LVSICCAFVGNSPIILIDDVHSDLDKRTQSL 712

  Fly   322 LISLLRSLARGGRTIVCTIHQPSARLFEKF-DHLYLLAQGQCVYEGRVKGLVPYLSSL---GYE- 381
            :.:|:.. .:..|||:...:.|:  |.|.. |.:.:::.|    |.:..|..|:|.::   ||. 
  Fly   713 VWNLINE-EKSKRTIILVSNSPA--LAENIADRMAIMSNG----ELKCTGTKPFLKNMYGHGYRL 770

  Fly   382 -CPSYHNPADYVLEVASGEYGDAVPKLVDAVKSGACKKYAHKDYVLTLAQKGCNNDIIKGSGSGA 445
             |....|   |..:...|.....:|.:......|         |.:|..               .
  Fly   771 TCVKGKN---YKRDELFGMMNSYMPNMSIERDIG---------YKVTFV---------------L 808

  Fly   446 ENAMAILTLEDEKPPLEDRQLEPSIPVDDPAELKPPKLETQQSQNSDCSVVNMPTNAVDDSCSFS 510
            ||     ..||:.|.|          :||        ||....|....|.....|:..:....|.
  Fly   809 EN-----KFEDQFPML----------IDD--------LEENMQQLGVVSFRIRDTSMEEIFLRFG 850

  Fly   511 SSKGTQNAVGGSGSGGPSAVVGCMTSLLDSHESVVTLPNKTGFPTSGWTQF-----------WIL 564
            .....|:   |:.....:|.|     ||:.:.|.:...|:.|..| ||..|           ||.
  Fly   851 CEDNDQS---GAFQSHENAQV-----LLEEYYSTLAEANEKGRRT-GWKLFFLHGRAVIYKRWIA 906

  Fly   565 LKRSFRTILRDKM---LTHMRLFSHVIVGAIIGMIYYDVGNEASKIMSNAGCIF----FVSLFT- 621
            ..|.:..::.:.:   |..:..||.:.:        |....|...:..|...:.    ||.||: 
  Fly   907 AHRHWIVLIFEVLAMALVAVCTFSSIFI--------YGKNYELEPLTFNLSQLHTVDAFVELFSE 963

  Fly   622 ---------------------------------------TFTAMMPTILTFPTEMSVFVREHLNY 647
                                                   .|||.:.:...|.   :.|.::.:..
  Fly   964 EEDVKDMHAYYTELLYWYDAHVATLTKNRHNAYALLTQNQFTAHVNSRYIFG---ATFDQKIVTA 1025

  Fly   648 W----------YSLKAFYFA-------------KTIADMPFQ----------------IVFSSVY 673
            |          |:|...:.|             .|:|.:||:                :.|...:
  Fly  1026 WFNNIPLHSAPYALNVVHNAVARHLFDEEATIDVTLAPLPFRTAINTFPPSSHTFGGCLAFGICF 1090

  Fly   674 VL-------VVYYLTSQPMELERVS-------------------MFVLI---CVLNSLVAQSLGL 709
            ||       .:|.:|.:...|::..                   :|:||   ||:         :
  Fly  1091 VLTFIWPAFAIYMITERGSLLKKQQFLAGVRVCSYWTFTVLYDLLFLLIFCACVV---------V 1146

  Fly   710 LIGAGMNIETGVFLGPVTTIPTILFSGFFVNFDTIPGYLQWVTYVSYVR--------YGFEGAMV 766
            ::....|....|.|....:: |::..||            ||..::|:.        |||    :
  Fly  1147 MVALYENPNHDVMLYGYISV-TLMLGGF------------WVILLAYLMASLCRNPCYGF----L 1194

  Fly   767 AIYGMDRAKMQCNQMYCHYRV-PKKFLEEMSMDNALFWVDAVALIGIFFALRIIAYFVLRWKLHM 830
            .:.|::...:.|...:  ||. |:..|.|.:                |.|:..:|..:.  ||.|
  Fly  1195 WLCGINSIGLVCFSQF--YRTHPESMLLEPT----------------FMAMYTVATVIC--KLFM 1239

  Fly   831 I 831
            |
  Fly  1240 I 1240

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AtetNP_001097079.1 3a01204 137..825 CDD:273361 165/839 (20%)
ABCG_EPDR 142..366 CDD:213180 66/240 (28%)
ABC2_membrane 564..767 CDD:279410 47/326 (14%)
CG1494NP_001259763.1 ABC2_membrane_3 <263..480 CDD:289468
CcmA 541..848 CDD:224054 84/375 (22%)
ABC_subfamily_A 541..761 CDD:213230 61/238 (26%)
ABC2_membrane_3 911..>1189 CDD:289468 43/311 (14%)
ABC2_membrane <1080..>1188 CDD:304374 20/130 (15%)
ABC_subfamily_A 1370..1577 CDD:213230
PRK14255 1371..1586 CDD:172743
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1131
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.