DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atet and Abca8

Sequence 1:NP_001097079.1 Gene:Atet FlyBaseID:FBgn0020762 Length:832 Species:Drosophila melanogaster
Sequence 2:XP_008766672.1 Gene:Abca8 RGDID:1307069 Length:1654 Species:Rattus norvegicus

Alignment Length:912 Identity:187/913 (20%)
Similarity:317/913 (35%) Gaps:321/913 (35%)


  Fly   120 SGG-----SPNGQKKGTIALSHLPQR---PPVDIEFCDISYSVTDSHRRGFKTILKSVSGKFRNG 176
            |||     ||....|.:|.:.::.:.   .|..||                  .||.::.....|
  Rat   462 SGGSFEPVSPEFHGKESIRIRNISKEYKGKPSKIE------------------ALKDLTLDIYEG 508

  Fly   177 EITAIMGPSGAGKSTLMNILAGYKTAQLSGSVLIN----SKERNLRRFRKLSCYIMQDDVLIANL 237
            :|||::|.||||||||:|||:|. :....|||.|.    |:..:|....::|....|.:|....|
  Rat   509 QITALLGHSGAGKSTLLNILSGL-SVPTKGSVTIYNNRLSEMADLESVFRISGVCPQSNVQFDFL 572

  Fly   238 TVREAMMVAANLKLGKNMISYAKV---------VVVEEILETIGLKESVNTLTCNLSGGQRKRLS 293
            ||||      ||:|      :||:         ..|:.:|..:.:|...:.|..||||||:::|:
  Rat   573 TVRE------NLRL------FAKIRGVPPQEVEKEVQRVLLELEMKNIQDILARNLSGGQKRKLT 625

  Fly   294 IALELVNNPPVMFFDEPTSGLDSSTCFQLISLLRS--------------------------LARG 332
            ....::.:..:...||||:|||..:..::.:||:.                          ::||
  Rat   626 FGTAILGDSQIFLLDEPTAGLDPFSRHRVWNLLKERKADRVVLFSTQFMDEADILADRKVFISRG 690

  Fly   333 GRTIVCTIHQPSARLFEKFD-----HLYLLAQGQCVYE---GRVKGLVPYLS-------SLGYEC 382
              .:.|.    .:.||.|..     ||.|..:..||.|   ..||..:|...       :|.|..
  Rat   691 --KLKCA----GSSLFLKKKWGVGYHLSLQLKEVCVPENITSLVKQHIPEAKLSAERERTLVYTL 749

  Fly   383 P---SYHNP-----ADYVLEVASGEYGDAVPKL-----------------VDAVKSGACKKYAHK 422
            |   :|..|     .|....:....||.::..|                 ||.|..|..::....
  Rat   750 PLETTYRFPELCQSLDSCPGLGIDSYGVSMTTLNEVFLKLEGKSAIEEPEVDIVGEGQTERSGDT 814

  Fly   423 DYVLTLAQK-GCNNDIIKGSGSGA---ENAMAI-----LTLEDEKPPLEDRQLEPSIPVDDPAEL 478
            :.::.:.|. ....:..|.:||.|   :...||     |.|:.|:..|....|...:.: .|...
  Rat   815 ERLMEMEQTLSTLTETKKKTGSLALWRQQTCAIAKARLLKLKHERKTLLSVLLVLGVAL-CPLLF 878

  Fly   479 KPPKLETQQSQNS-DCS--------------------VVNMPTNAVDDSCSFSSSKGTQN---AV 519
            :..|::..||..: |.|                    ::|....::||   |..|...||   .|
  Rat   879 ESIKMKILQSAYTWDLSPHSYFLAPGQQPHGMLTQLLIINKTEASIDD---FIQSVERQNIALEV 940

  Fly   520 GGSGS---------GGPSAVVG---------------CMTSL--------LDSHESVVTLPNKTG 552
            ..||:         .|...|.|               |..::        ...:|.|....:|..
  Rat   941 DASGARDGTDDPSFNGALTVSGGEKVCWSPAQKLHQVCQDNIALRYPGLQCKKYEVVQNQAHKLE 1005

  Fly   553 FPTSGWTQFWILLKRSFRT--------------ILRDKMLTHMRLFSHVIVGAIIGMIYYDVGNE 603
            .|...|        |:.:|              ..||....|:.               :...:|
  Rat  1006 GPRKVW--------RAQQTPEAYNRFSGSKIYARKRDSEFVHLD---------------FPFQDE 1047

  Fly   604 ASKIMSNAGCIFFVSLFTTFTAMMPTILTFPTEMSVFVREHLN-YWYSLK-------AFYFAKTI 660
            .:..:...|...|   :.|.|:..|..:...:     |.::.| .|:.|:       |::|.:.:
  Rat  1048 ITNPLQQLGKTTF---WLTLTSACPPYIAMSS-----VTDYKNKVWFQLRVSGLFPSAYWFGQAL 1104

  Fly   661 ADMPFQIVFSSVYVLVVYYLTSQPMELERVSMFVLICVLNSLVAQSLGLLIGAGMNIETGVFLGP 725
            .|:|. ..|..:::.::.||...|    ..::.|:..||.  :..|:|..|              
  Rat  1105 VDIPL-YCFVFLFMSLMDYLLGFP----DATLIVITHVLQ--IPCSVGYAI-------------- 1148

  Fly   726 VTTIPTILFSGFFVNFDTIPG-----------YLQWVTYVSYVRYGFEGAMVAIYGMDRAKMQCN 779
                 :::|..:.::|.:..|           |:  :|..|.|      ||:..:.:|..     
  Rat  1149 -----SLIFLTYVISFISRKGKKNSGIWSLCFYI--ITMFSVV------AMLLDFNVDAI----- 1195

  Fly   780 QMYC-HYRVPKK------------FLEEMSMDNAL---FWVDAVALIGIF---FALRIIAYFVLR 825
             :|| .:.:|..            |:..:|.:.::   |.|..:.|:.:|   |.||     .|.
  Rat  1196 -LYCIIFLLPPSTLIGCLILSMHLFIYRISREESIVEPFLVFLIPLLHVFIFIFTLR-----CLE 1254

  Fly   826 WK 827
            ||
  Rat  1255 WK 1256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AtetNP_001097079.1 3a01204 137..825 CDD:273361 178/887 (20%)
ABCG_EPDR 142..366 CDD:213180 73/271 (27%)
ABC2_membrane 564..767 CDD:279410 38/236 (16%)
Abca8XP_008766672.1 ABC2_membrane_3 <178..417 CDD:289468
ABC2_membrane <273..386 CDD:304374
CcmA 477..792 CDD:224054 86/352 (24%)
ABC_subfamily_A 479..702 CDD:213230 67/260 (26%)
ABC2_membrane <1062..1182 CDD:304374 26/153 (17%)
ABC2_membrane_3 <1071..1247 CDD:289468 37/221 (17%)
CcmA 1311..1630 CDD:224054
ABC_subfamily_A 1318..1539 CDD:213230
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1131
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.