DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atet and Abca13

Sequence 1:NP_001097079.1 Gene:Atet FlyBaseID:FBgn0020762 Length:832 Species:Drosophila melanogaster
Sequence 2:NP_839990.2 Gene:Abca13 MGIID:2388707 Length:5034 Species:Mus musculus

Alignment Length:1042 Identity:204/1043 (20%)
Similarity:344/1043 (33%) Gaps:371/1043 (36%)


  Fly    41 NAVLYTSGNMSLSTLSTGS---GNPNPNPNASTN-------SRQEPVPLLSQLKLTNDLKQNSHG 95
            :|:||..|....|.|..|:   |.|...|..::.       ..:....|.|.|...|:       
Mouse  3730 DAILYFLGGWYFSNLVPGTFGLGKPWYFPFTASYWKSICGLMERRRCSLSSGLFFFNE------- 3787

  Fly    96 SQNNLCNGGLGSNNHALAPKVANNSGGSPNGQKKGTIALSHLPQRPPVDIEFCDISYSVTDSHRR 160
               :..|.||...|   .|  ....||:|.      :||                 .|||..: .
Mouse  3788 ---DFGNKGLSQQN---GP--GEMEGGNPG------VAL-----------------ISVTKEY-E 3820

  Fly   161 GFKTILKSVSGKFRNGEITAIMGPSGAGKSTLMNILAGYKTAQLSGSVLINSK--ERNLRRFRKL 223
            ..|..::.::..|...:|||::|.:||||:|::::|.|. ....||::.||.|  :.:|.:.|:.
Mouse  3821 DHKVAVQELTLTFHRDQITALLGTNGAGKTTIISMLMGL-FPPTSGTITINGKNLQTDLSKVREE 3884

  Fly   224 SCYIMQDDVLIANLTVREAMMVAANLK----LGKNMISYAKVVVVEEILETIGLKESVNTLTCNL 284
            .....|.|||:.||||||.:|:.|::|    ..|.:...     |.:.|:.:.|.:..:.....|
Mouse  3885 LGVCPQQDVLLDNLTVREHLMLFASIKAPWWTTKELQQQ-----VNKTLDEVELTQHQHKPAGVL 3944

  Fly   285 SGGQRKRLSIALELVNNPPVMFFDEPTSGLDSSTCFQLISLLRSLARGGRTIVCTIHQ-PSARLF 348
            |||.:::|||.:..:.....:..|||:||:|..:...|..:|... |.||||:.|.|. ..|.:.
Mouse  3945 SGGMKRKLSIGIAFMGMSKTVVLDEPSSGVDPCSRRSLWDILLKY-REGRTIIFTTHHLDEAEML 4008

  Fly   349 EKFDHLYLLAQG--QC------VYEGRVKGLVPYLSS----LGYECP----------SYHNPADY 391
            .  ||:.:|.||  :|      :.|...:||...||.    |..:.|          ..:.|..:
Mouse  4009 S--DHVAVLQQGRLRCYAPPADLKETYGQGLTLTLSKQPSILETQEPKDVARVTSLIQIYIPQAF 4071

  Fly   392 VLEVASGEYGDAVPKLVDAVKS---GACK------KYAH------------------------KD 423
            :.:...||....:||  ||.::   |.|:      ::.|                        |.
Mouse  4072 LKDSCGGELTYTIPK--DADRTCFKGLCQALDQNLQHLHLTGYGISDTTLEEVFLMLLQDTNKKS 4134

  Fly   424 YV------------------------LTLAQKGCNNDIIKGSGSGAENAMAIL------TLEDEK 458
            |:                        |:...:|...:.|.|.......|:|:|      ||...|
Mouse  4135 YITPDNKVEPQNERPVGPLSPHNVSPLSTPPEGALPEPIGGCQLLLGQAVALLRKRLLHTLRAWK 4199

  Fly   459 PPLEDRQL--------------EPSIPVDDPAELKPPKLETQQS--------------------- 488
            ....|..|              :|......|.:|.|...||.::                     
Mouse  4200 STTSDLLLPVLFVALAMGLFMVQPLAITYPPLKLTPGHYETAETYFFSSGNHGPDLTHVLLRKFR 4264

  Fly   489 -QNSDCSVVNMPTNAVDDSCSFSSSKGTQNAVGG-------------SGSGGPSAVVGCMTSLLD 539
             |:..|:          |:...:||...::...|             :.|.|..::..|:     
Mouse  4265 DQDPVCA----------DAFRMNSSSWHRDPYSGPESQDSCGCLKCPNKSAGAPSLTNCL----- 4314

  Fly   540 SHESVVTLPNKTGF--------PTS-----GWT-----------------------QFWILLK-- 566
            .|    ||.|.:|:        |::     ||:                       :.|...|  
Mouse  4315 GH----TLLNLSGYDVEEYLLVPSAKPRLGGWSFGGQIPNDAEDVKTNTSKPRTLAKVWYNQKGF 4375

  Fly   567 ---RSFRTILRDKMLTH-------------MRLFSHVIVGAIIGMIYYDVGNEASKIMSNAGCIF 615
               .|:...|.:.:|.|             :.|:||...||::        ||...:.|...|..
Mouse  4376 HSLPSYLNHLNNLILWHHLPANAVDWRQYGITLYSHPYGGALL--------NEDRILESIRQCGV 4432

  Fly   616 FVSLFTTFTAMMPTILTFPTEMSVFVRE---------------HLNYW----------------- 648
            .:.:...|:.:..:|      .|..||:               |..||                 
Mouse  4433 ALCIVLGFSILSASI------GSSVVRDRVTGAKRLQHISGLGHRTYWLINFLYDMLFYLVSVCL 4491

  Fly   649 -------YSLKAFYFAKTIADMPFQIVFSSVYVLVVYYLTSQPMELERVSMFVLICVLNSLVAQS 706
                   :.|.||.|.:.:|.....:......::...||.|:......|:....|         |
Mouse  4492 CVAVIGAFQLTAFTFRENLAATALLLALFGYAMIPWMYLMSRIFSSSDVAFISYI---------S 4547

  Fly   707 LGLLIGAGMNIETGVFLGPVTTIPTIL-FSGFFVNFDTIPGYLQWVTYVSYVRYGFEGAMVAIYG 770
            |..:.|....:        :||:|.:| ......|...|...|:| .:..:.::.....::.:  
Mouse  4548 LNFIFGLCTML--------MTTMPRLLAIISKAQNLQKIYNVLKW-AFTIFPQFCLGQGLIEL-- 4601

  Fly   771 MDRAKMQCNQMYCHYRVPKKFLEEMSMD--------NALFWVDA-VALIGIF-FALRIIAY-FVL 824
                        |:.::.........:|        |.|.|:.. :.|.|.| ..||::.: .:|
Mouse  4602 ------------CYNQIKYDLTHNFGIDSYVSPFEMNFLGWIFVELTLQGTFLLLLRLMLHGDLL 4654

  Fly   825 RW 826
            ||
Mouse  4655 RW 4656

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AtetNP_001097079.1 3a01204 137..825 CDD:273361 178/934 (19%)
ABCG_EPDR 142..366 CDD:213180 70/239 (29%)
ABC2_membrane 564..767 CDD:279410 43/261 (16%)
Abca13NP_839990.2 rim_protein 3036..5019 CDD:130324 204/1043 (20%)
ABC_subfamily_A 3815..4030 CDD:213230 68/225 (30%)
ABC_subfamily_A 4692..4919 CDD:213230
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1131
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.